PRGDB00064247 (Zm.64678)

From PRG Wiki
Jump to: navigation, search
Zm.64678
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195616555 (EU957990)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1639445 mRNA sequence

DNA Sequence

GGACTGCCGCTCGGTGGGGCAACACATCTTGGACGGCGGATCTCAAGAGGGCAAGGGAGCAAGCCTTCCTGTGAGACGTCGACCTGCTGCTGTCCCTCTTCTCCCGCGCCGCACAAGACTGGTGGCAGCAGCACGCGCCACGATCCTCCTCGACCCTCCGGCCTCTCCCCTCCCTGCACCTGCAGAGAGCGCCGCAAGCTAGCTGCAGAGGAGCAAAACAGCAGGAGGAGGACGAAAGGAAGAAGAGAAGGCGAGCGGCTGAATCCTCCCTCGATCACCACACGCGCTCTGCCCTTCCCCGCCACCGATCTGCCACCTCCGAGCTTGTCCGCCAACGCCGGATCTGCCGGCCACGTGATGCGGCTCAGGCGACGGACAGAGCCTACGGGCAGCGGCGGCGCCAAAACCTAGCTCTGGATACCATGTCGTTTTCTGGTAGGGGCGCTTCCCCTCCTGGTGCATGTATAAAAAAGTTCGAAGGAAGAGCAGTTTGCTGAAAATTTTACTCCCAATTATACTGTGTGTGCTGCTACTCATGCTTGGAGCCCTTGTCTGGACATGTAAAAGCAGAGGCAAACGGCAAAAGAAGAGAGTTCAAAAGAGAAGGATGCTAGAATACTTGAGTTCTACTGATGACGCTGGGGACAAGAACATAAACTTCCCATTTATTAGCTTTGAAAACATTGTCACAGCAACAGATAATTTCTCTGAATCTAATTTGCTTGGGAAAGGAGGTTTTGGCAAAGTGTACAAGGGAATGTTGGAAGGCACAAAGGAAGTAGCTGTCAAGAGACTTAGCACGGGTTCCGGCCAAGGCAAGGAGGAGTTCAAAAATGAAGTAGTCCTAATTGCAAAGTTGCAGCACAAGAACCTAGTTAAGCTTCTCGGTTGTTGTATTCATGAAGATGAGAAGCTGTTAGTTTATGAGTACTTACCCAACAAAAGCTTGGATTACTTCCTCTTTGGTATTTTGAAATTCCAGTTTTTGATACTGTTAATGATGTCCAACAAATAAATGTCCTGTGTGCCTGCTGATATGCCCTGTTTTATATTATTCTTATTAGCTTCTGCAAGAAAATCAATGCTTCAGTGGCCAACAAGGTTCAAGATAATCCAGGGGGTTGCTAGAGGAATTATGTATCTCCATCATGACTCAAGATTAACTGTAATTCATCGAGATCTAAAAGCAAGCAACATCTTGCTAGATAAGGAGATGAACCCAAAGATATCAGATTTCGGCATGGCTAGGATATTCTCTGGTGATCAGCTCCAAGCAAATACTAACCGAGTTGTAGGGACATAGTAAGTAACTATTGCAGTGCCAACTCTACAGATAGAATTGATTTGTTTTATAGTTTTAAAAAAATATGCAATCCTTTTTGGTCAAATGTTTTGCACAGTGGCTACATGTCTCCTGAATATGCAATGAAAGGTGCATTTTCAGTTAAGTCTGACACCTACAGCTTTGGTGTTCTTATATTGGAGATTGTAAGTGGATTAAAGATAAGCTCACCATATCTTATCATGGATTTTTCTAACCTTATAACATTTGTAAGTATTGGGAGACGCTCAGAATTTAGAAATATCCACAGGAAAACAGCATGCAAGCTTAATGTGCGATTGTGTCATGTTGCAGGCATGGAACATGTGGAAAGATGGGAAACCAGAAGATTTTCTTGACTCATCTGTAACGGAGAGTTGCTCCCTCGATGAAGTTTCACGATGCATCCATATAGGACTCCTGTGCGCTCAAGACAATCCGAGTTGCAGGCCACTCATGTCAACAGTTGTGTCCATGCTGGAGAACAAAGCAACACCACTGCCAACACCGAAGCAACCTAAAGATTTTGCACTTCGGGACTACAATCCTGGAAACGAAGGTGTCCACAGGGAATTGTCCGTAAATGATACAAGTCTCACTATGGTGGAGGGCCGTTAGATTATTGTTTTTGATACTACGATGGGGGAGCACATAGCCCACCAGAAATATTCATTGAAGACAGACGTTTAGTCCCTATTTTGTTTATGGGTATTTCTGTTTAGACAAATTTAGTATCAATTTAATCTATAAAATTTATTATGCAAGAACATCTATTGGAAAGGTAAAGTTTATTATGCAATTTATCAATTTAGGTTTAGATTCaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.64678 translated coding region predicted by ESTScan from UniGene Zm.64678

XDCRSVGQHILDGGSQEGKGASLPVRRRPAAVPLLPRRTRLVAAARATILLDPPASPLPAPAESAASXLQRSKTAGGGRKEEEKASGXILPRSPHALCPSPPPICHLRACPPTPDLPATXCGSGDGQSLRAAAAPKPSSGYHVVFWXGRFPSWCMYKKVRRKSSLLKILLPIILCVLLLMLGALVWTCKSRGKRQKKRVQKRRMLEYLSSTDDAGDKNINFPFISFENIVTATDNFSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSMLENKATPLPTPKQPKDFALRDYNPGNEGVHRELSVNDTSLTMVEGR

Domains

Domain Start-End Description Sequence

Seg: seg
23-48 seg

LPVRRRPAAVPLLPRRTRLVAAARAT

Seg: seg
50-69 seg

LLDPPASPLPAPAESAASXL

HMMPanther: PTHR24420:SF432
160-614 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RRKSSLLKILLPIILCVLLLMLGALVWTCKSRGKRQKKRVQKRRMLEYLSSTDDAGDKNINFPFISFENIVTATDNFSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSMLENKATPLPTPKQP

HMMPanther: PTHR24420
160-614 FAMILY NOT NAMED,FAMILY NOT NAMED

RRKSSLLKILLPIILCVLLLMLGALVWTCKSRGKRQKKRVQKRRMLEYLSSTDDAGDKNINFPFISFENIVTATDNFSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSMLENKATPLPTPKQP

Seg: seg
165-184 seg

LLKILLPIILCVLLLMLGAL

Seg: seg
189-203 seg

KSRGKRQKKRVQKRR

superfamily: SSF56112
IPR011009
208-624 Protein kinase-like (PK-like)
Protein kinase-like domain

LSSTDDAGDKNINFPFISFENIVTATDNFSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSMLENKATPLPTPKQPKDFALRDYNP

Gene3D: G3DSA:3.30.200.20
222-297 no description

PFISFENIVTATDNFSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLG

ProfileScan: PS50011
IPR000719
236-609 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSMLENKATPLP

HMMSmart: SM00220
IPR002290
236-601 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSML

HMMSmart: SM00219
IPR020635
236-601 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSESNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIGRRSEFRNIHRKTACKLNVDCVMLQAWNMWKDGKPEDFLDSSVTESCSLDEVSRCIHIGLLCAQDNPSCRPLMSTVVSML

HMMPfam: PF00069
IPR017442
239-502 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNLLGKGGFGKVYKGMLEGTKEVAVKRLSTGSGQGKEEFKNEVVLIAKLQHKNLVKLLGCCIHEDEKLLVYEYLPNKSLDYFLFGILKFQFLILLMMSNKXMSCVPADMPCFILFLLASARKSMLQWPTRFKIIQGVARGIMYLHHDSRLTVIHRDLKASNILLDKEMNPKISDFGMARIFSGDQLQANTNRVXRDIVSNYCSANSTDRIDLFYSFKKICNPFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLK

PatternScan: PS00107
IPR017441
242-264 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGKVYKGMLEGTKEVAVK

PatternScan: PS00108
IPR008271
390-402 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKASNILL

Gene3D: G3DSA:1.10.510.10
460-522 no description

PFWSNVLHSGYMSPEYAMKGAFSVKSDTYSFGVLILEIVSGLKISSPYLIMDFSNLITFVSIG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox