PRGDB00064248 (Zm.64702)

From PRG Wiki
Jump to: navigation, search
Zm.64702
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195656892 (EU975796)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 501220 mRNA sequence

DNA Sequence

ACCAACACAACAACATCTCCTCCATTCTCCTAGCTCCAGCAACAAACAGGACACAACACCTTCTCCTCCTCATTCTTCTACCATAGCTAGCTAGCTAGCTTCACATCAGCAGCTACATACTCACCGATAGATACAGACCTCAGAGCATCACACTACAGAGTACAGACCTAGCTCAGAGCACACATCCAGCCATGGGGCTCCTCCCTACCGACCGCATGGATAGCCTCTTCTCCCCGCGCTGCGTGTGGGTGACCGGGCCCATCATCGTGGGCGCGGGGCCGTCGGGGCTAGCCGTGGCGGCGTGCCTGCGGGAGCAGGGCGTGCCGTTCGTCGTCCTGGAGCGCGCCGACTGTATCGCCTCGCTGTGGCAACGGCGCACGTACAACCGCCTCAAGCTGCACCTACCCAAGCAGTTCTGCCAGCTCCCGCGCATGCCGTTCCCGGAAGACTACCCGGAGTACCCGACCCGCCGCCAGTTCGTCGACTACCTCGAGCGCTACGCCGCCGAGTTCGAGATCAAGCCGGAGTTCGGCACCACCGTGCTGTCGGCGCGCTACGACGAGACGTCGGGCCTCTGGCGCGTCGTCACCAACGGCGGAGCCGGCGGCGACATGGAGTACATCGGGCGCTGGCTCGTGGTCGCCACGGGCGAGAACGCGGAGGCCGTGGTGCCCGACATCCCGGGCCTCGCCGGCTTCGACGGCGAGGTGACCCACGTGAGCGAGTACAAGTCCGGCGAGGCCTACGCCGGCAAGCGCGTGCTGGTGGTCGGCTGCGGCAACTCCGGGATGGAGGTGTCGCTGGACCTGGCCGAGCACGGCGCGCGCCCGGCCATGGTGGTGCGCGACGCCGTCCACGTCCTCCCGCGCGAGGTGCTGGGCACGTCCACCTTCGGGCTCGCCGTGCTGCTCATGCGCTGGCTCCCGCTCTGGCTCGTCGACTGGCYCATGGTGCTCCTCGGCGTGGCTCGTCCTCGGCAACCTCGCCAGGCTCGGCCTccgccgccccgccgccggcccgcTCCAGCTCAAGGAGACGCACGGCCGCACACCAGTCCTCGACTACGGCGCGCTCGCGCGCATCCGCGCCGGCGACATCACCGTCGTCCCTGCGGTGACACGGTTCGCCGGCAAGGGCGGACAGGTTGAGGTCGCCGACGGCCGCACGCTCGGCTTCGACGCCGTCATCCTCGCCACCGGATATCGCAGCAACGTGCCGCAGTGGCTCCAGGGCAACGATTTCTTCAACAAGGACGGATACCCCAAGACGGCGTTCCCGCACGGGTGGAAGGGCGAGAGTGGGCTGTACGCCGTGGGGTTCACCCGGCGCGGCCTCTCCGGCGCCTCCGCCGACGCCGTGCGCATCGCCACGGACCTCGGGAACGTCTGGAGGGAGGAGACCAAGCCCACCAAGAGGGCCGGCGCCTGCCACAGGCGCTGCATCTCGGTCGTCTTCTAATCCGATCGGCCACACCTGGGAGCATGCATGACGATGATTGAAGCTAACTTTTCTGAAGCGCAGAARaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaargaaaaaaaaaaaaaaaaaWTTTCGTTCCCGTCAACCT


Protein sequences

Name Description Sequence
Zm.64702 translated coding region predicted by ESTScan from UniGene Zm.64702

MGLLPTDRMDSLFSPRCVWVTGPIIVGAGPSGLAVAACLREQGVPFVVLERADCIASLWQRRTYNRLKLHLPKQFCQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEFGTTVLSARYDETSGLWRVVTNGGAGGDMEYIGRWLVVATGENAEAVVPDIPGLAGFDGEVTHVSEYKSGEAYAGKRVLVVGCGNSGMEVSLDLAEHGARPAMVVRDAVHVLPARCWARPPSGSPCCSCAGSRSGSSTGXWCSSAWLVLGNLARLGLRRPAAGPLQLKETHGRTPVLDYGALARIRAGDITVVPAVTRFAGKGGQVEVADGRTLGFDAVILATGYRSNVPQWLQGNDFFNKDGYPKTAFPHGWKGESGLYAVGFTRRGLSGASADAVRIATDLGNVWREETKPTKRAGACHRRCISVVF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
7-404 MONOOXYGENASE,MONOOXYGENASE

DRMDSLFSPRCVWVTGPIIVGAGPSGLAVAACLREQGVPFVVLERADCIASLWQRRTYNRLKLHLPKQFCQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEFGTTVLSARYDETSGLWRVVTNGGAGGDMEYIGRWLVVATGENAEAVVPDIPGLAGFDGEVTHVSEYKSGEAYAGKRVLVVGCGNSGMEVSLDLAEHGARPAMVVRDAVHVLPARCWARPPSGSPCCSCAGSRSGSSTGXWCSSAWLVLGNLARLGLRRPAAGPLQLKETHGRTPVLDYGALARIRAGDITVVPAVTRFAGKGGQVEVADGRTLGFDAVILATGYRSNVPQWLQGNDFFNKDGYPKTAFPHGWKGESGLYAVGFTRRGLSGASADAVRIATDLGNVWREETK

HMMPanther: PTHR23023
7-404 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

DRMDSLFSPRCVWVTGPIIVGAGPSGLAVAACLREQGVPFVVLERADCIASLWQRRTYNRLKLHLPKQFCQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEFGTTVLSARYDETSGLWRVVTNGGAGGDMEYIGRWLVVATGENAEAVVPDIPGLAGFDGEVTHVSEYKSGEAYAGKRVLVVGCGNSGMEVSLDLAEHGARPAMVVRDAVHVLPARCWARPPSGSPCCSCAGSRSGSSTGXWCSSAWLVLGNLARLGLRRPAAGPLQLKETHGRTPVLDYGALARIRAGDITVVPAVTRFAGKGGQVEVADGRTLGFDAVILATGYRSNVPQWLQGNDFFNKDGYPKTAFPHGWKGESGLYAVGFTRRGLSGASADAVRIATDLGNVWREETK

FPrintScan: PR00469
IPR000103
22-44 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPIIVGAGPSGLAVAACLREQGV

FPrintScan: PR00368
IPR013027
23-42 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PIIVGAGPSGLAVAACLREQ

superfamily: SSF51905
24-225 FAD/NAD(P)-binding domain

IIVGAGPSGLAVAACLREQGVPFVVLERADCIASLWQRRTYNRLKLHLPKQFCQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEFGTTVLSARYDETSGLWRVVTNGGAGGDMEYIGRWLVVATGENAEAVVPDIPGLAGFDGEVTHVSEYKSGEAYAGKRVLVVGCGNSGMEVSLDLAEHGARPAMVVRDAVHVLP

Gene3D: G3DSA:3.50.50.60
24-218 no description

IIVGAGPSGLAVAACLREQGVPFVVLERADCIASLWQRRTYNRLKLHLPKQFCQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEFGTTVLSARYDETSGLWRVVTNGGAGGDMEYIGRWLVVATGENAEAVVPDIPGLAGFDGEVTHVSEYKSGEAYAGKRVLVVGCGNSGMEVSLDLAEHGARPAMVVR

HMMPfam: PF00743
IPR020946
25-342 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLAVAACLREQGVPFVVLERADCIASLWQRRTYNRLKLHLPKQFCQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEFGTTVLSARYDETSGLWRVVTNGGAGGDMEYIGRWLVVATGENAEAVVPDIPGLAGFDGEVTHVSEYKSGEAYAGKRVLVVGCGNSGMEVSLDLAEHGARPAMVVRDAVHVLPARCWARPPSGSPCCSCAGSRSGSSTGXWCSSAWLVLGNLARLGLRRPAAGPLQLKETHGRTPVLDYGALARIRAGDITVVPAVTRFAGKGGQVEVADGRTLGFDAVILATGYRSNVP

FPrintScan: PR00469
IPR000103
185-209 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

YAGKRVLVVGCGNSGMEVSLDLAEH

superfamily: SSF51905
188-406 FAD/NAD(P)-binding domain

KRVLVVGCGNSGMEVSLDLAEHGARPAMVVRDAVHVLPARCWARPPSGSPCCSCAGSRSGSSTGXWCSSAWLVLGNLARLGLRRPAAGPLQLKETHGRTPVLDYGALARIRAGDITVVPAVTRFAGKGGQVEVADGRTLGFDAVILATGYRSNVPQWLQGNDFFNKDGYPKTAFPHGWKGESGLYAVGFTRRGLSGASADAVRIATDLGNVWREETKPT

FPrintScan: PR00368
IPR013027
189-207 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEVSLDLA

Seg: seg
234-256 seg

SGSPCCSCAGSRSGSSTGXWCSS

Gene3D: G3DSA:3.50.50.60
290-396 no description

DYGALARIRAGDITVVPAVTRFAGKGGQVEVADGRTLGFDAVILATGYRSNVPQWLQGNDFFNKDGYPKTAFPHGWKGESGLYAVGFTRRGLSGASADAVRIATDLG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox