PRGDB00064251 (Zm.66619)

From PRG Wiki
Jump to: navigation, search
Zm.66619
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194704319 (BT041239)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0191M14 mRNA, complete cds

DNA Sequence

GAAGCCAAAAGCAACCAAACCCACCCGGCCACCCCCCGAGCCCGAAGGCAGGCCTCTTTCTTCTTCTTCCTCCTCTTCCCCTGCTCGGTCGGCTACTCCTACTGTCCGGGGAACCCAGCCCAGCCCAGCACCTGAACCccacaccacacacacagggttgcccacccacgccacgcacGCGCAGCCGCGGCGGAAGCCACCGGGGGGTGGGCTCCGATGGGCTGCTGCGGCTCCTCGCAGCGGGCGGGGACGCACCCGGAGAAGAAGCCGCCGGGGGCGCTCCCCCCGCACCGTCCCTCCTACTCGCTCAACCAGCACCAggcgccggcgccgccgcctccctccgcggctcgcgccggcgcccgccaggtgccgccgcTCAAGGAGTTCTCGCTCGCGGAGCTGCGCGCCGCCACGGCCGGCTTCGCGGCGGGGAACATCGTGTCGGAGAGCGGCGAGAAGGCGCCCAATTTCGTGTACAGGGGCCGCCTCGACGCCGGCCGCCGCGCGATCGCCGTCAAGAAGTTCACCAAGATGGCGTGGCCCGATCCCAAGCAGTTCGCGGAGGAGGCCAAGGGCGTCGGGAAGCTGCGCCACTGCCGCCTGGCCAACCTCATCGGCTACTGCTGCGACGGGGACGAGCGGCTGCTCGTCGCCGAGTTCATGCCCAACGACACGCTCGCCAAGCACCTCTTCCACTGGGAAAACCAGACAATTGAATGGGCTATGCGTCTGAGAGTTGCATACTACATCGCTGAAGCACTGGAGTATTGCAGCACTGAGGGAAGGCCTTTGTACCACGACCTAAATGCATATAGGGTCCTCTTTGATGAGAATGGTGATCCTCGCCTTTCATGCTTTGGCCTGATGAAAAACAGTAGGGATGGGAAAAGCTATAGCACAAATCTTGCATATACACCTCCAGAATATTTAAGAAATGGAAGAGTAACATCAGAAAGTGTCATATTCAGCTTTGGCACTATACTGCTGGACCTCCTAAGTGGAAAGCGTATACCTCCTTCCCGTGCTCTTGATATGATAAAAGGCAACAATATCCAAGTACTGATGGATTCACATTTGGAGGGAAACTACTCAACAGATGAGGCAACCACATTGGTTGACCTGGCCTCCCAGTGCCTACAGTATGAGCCTAGGGATCGGGCCAACACTAAAAAGCTGGTTTCCGTACTCGAGCCCTTGCAAATAAAATCAGAGGTACCATCCTACGAGATGCTTGGCATTCCAAAACATGAGGAAGAAGCGCCTCCCCCTCCACAACCGCAGCGCCCTCTCTCTCCCATGGGTGAAGCCTGTTCTAGGACGGATCTGACAGCTATCCATCAAATTCTAGTGAACACGCATTACAGGGACGATGAAGGGAGCAACGAGCTATCGTTCCAGGAATGGACGCAGCAGATGAGGGACATGCTGGAAGCTAGGAAGCGTGGGGACTTCGCCTTTCGCGATAAAGATTTCAAGGCAGCCATAGATTGCTACACGCAGTTCGTTGACGTGGGGACGATGGTATCGCCAACGGTGTACGCGAGGCGGAGCCTGTGCCACCTCATGTGTGACCAGCCTGACGCCGCCCTCCGCGACGCAATGCAGGCGCAGTGCGTGTACCCGGACTGGCCAACCGCGTTCTACATGCAAGCTGTCGCGCTCGCGAAGCTGAACATGCAGAGCGATGCCACGGACATGTTGAACGAGGCATCGCAGCTCGAAGAGAAGCGGCAGAAGAACACAAAACCCTGATGATGGCTTGTTCCTGGTCCAGGGGTTGGGAATGTAGCTGGGGGAGTGTGCTGCAGAGTCCTGCGATTGTAACTACCTGGTTTCGCATTTCTGTCATGCAttttttttGGGCCCGTGTACATGTTACATCGACGAAAGTCGAAACAGGCAGAATGCAAGGGGATTTTTTT


Protein sequences

Name Description Sequence
Zm.66619 translated coding region predicted by ESTScan from UniGene Zm.66619

XKPKATKPTRPPPEPEGRPLSSSSSSSPARSATPTVRGTQPSPAPEPHTTHTGLPTHATHAQPRRKPPGGGLRWAAAAPRSGAGTHPEKKPPGALPPHRPSYSLNQHQAPAPPPPSAARAGARQVPPLKEFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPLQIKSEVPSYEMLGIPKHEEEAPPPPQPQRPLSPMGEACSRTDLTAIHQILVNTHYRDDEGSNELSFQEWTQQMRDMLEARKRGDFAFRDKDFKAAIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQAQCVYPDWPTAFYMQAVALAKLNMQSDATDMLNEASQLEEKRQKNTKPXXWLVPGPGVGNVAGGVCCRVLRL

Domains

Domain Start-End Description Sequence

Seg: seg
2-34 seg

KPKATKPTRPPPEPEGRPLSSSSSSSPARSATP

Seg: seg
109-122 seg

APAPPPPSAARAGA

superfamily: SSF56112
IPR011009
115-421 Protein kinase-like (PK-like)
Protein kinase-like domain

PSAARAGARQVPPLKEFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPLQIKSEVPSYEMLGIPKHEEE

HMMPanther: PTHR24420
123-477 FAMILY NOT NAMED,FAMILY NOT NAMED

RQVPPLKEFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPLQIKSEVPSYEMLGIPKHEEEAPPPPQPQRPLSPMGEACSRTDLTAIHQILVNTHYRDDEGSNELSFQEWTQQMRDM

HMMPanther: PTHR24420:SF885
123-477 SUBFAMILY NOT NAMED

RQVPPLKEFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPLQIKSEVPSYEMLGIPKHEEEAPPPPQPQRPLSPMGEACSRTDLTAIHQILVNTHYRDDEGSNELSFQEWTQQMRDM

Gene3D: G3DSA:3.30.200.20
128-222 no description

LKEFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEF

ProfileScan: PS50011
IPR000719
146-402 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPLQ

HMMSmart: SM00220
IPR002290
146-401 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPL

HMMPfam: PF07714
IPR001245
160-398 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVL

HMMSmart: SM00219
IPR020635
160-398 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVL

Gene3D: G3DSA:1.10.510.10
223-404 no description

MPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTLVDLASQCLQYEPRDRANTKKLVSVLEPLQIK

Seg: seg
423-431 seg

PPPPQPQRP

superfamily: SSF48452
468-578 TPR-like

QEWTQQMRDMLEARKRGDFAFRDKDFKAAIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQAQCVYPDWPTAFYMQAVALAKLNMQSDATDMLNEASQLEEK

HMMPfam: PF13414
478-538 TPR_11,TPR repeat

LEARKRGDFAFRDKDFKAAIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQA

Gene3D: G3DSA:1.25.40.10
IPR011990
479-578 no description
Tetratricopeptide-like helical

EARKRGDFAFRDKDFKAAIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQAQCVYPDWPTAFYMQAVALAKLNMQSDATDMLNEASQLEEK

Coil: coil
558-579 coiled-coil

KLNMQSDATDMLNEASQLEEKR

Seg: seg
585-606 seg

PXXWLVPGPGVGNVAGGVCCRV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox