PRGDB00064254 (Zm.67039)

From PRG Wiki
Jump to: navigation, search
Zm.67039
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223947958 (BT063366)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0057F06 mRNA, complete cds

DNA Sequence

CGGGTCGGAACCTCAGCTCAGAGGATCGGAAGAACGGACGACGGCGAGATGGCAAGCGGGGAAGAAGGCAAGGGCGAGACGGTGCTGGTCACCGGGGCCAGCGGCTTCATCGGTTCGACCCTCGTCCGCGGCCTCCTCGGCCGCGGCTACAACGTCCGCGCCGGCGTCCTCGACCCCGGTCAGTAGAGTACAGTAGCCCTAGCCCCGCACTCTCCGCCGGCTTTGCTTCCTCTCCTCCTGAACAAGCGTCGCCATGAATAATGACGCCGGGAGAGAAAGCTGCTGGCCCCTTGCCCGCCTGCGACGCGGCGCTCGCTCAGCTCATCGAGTGCGCCGCGGTGGTGTGCATGCAGACGACAGGGCGGAGACGGAccacctcctcgcgctcgccgccggcgccggccgccTCAGCTTCTTCCGCTGCGACCTCCTGGACGGCGCCGCGCTGCTCGACGCGGCAAGGGGGTGCTCGGGCGTCTTCCACCTCGCGTCACCCTGCACCGTCGACCCCGTCAAGGACCCCCAGAATCAGCTGATGGTGCCTGCGGTGGAAGGGACGCTGAACGTGGTGCGCGCGGCCAAGGACGCCGGCGGAGTGCGGCGGGTGGTCGTGACCTCGTCCATCTCGGCCGTCGTGCCCAACCCCGGGTGGCCCGCCGGCGAGGTCGTCGACGAGCGTTGCTGGACCGACATCGACTACTGCGAGAAGAATGGGGTTTGGTACCCTGCTTCCAAGACGCTGGCGGAGAAGGCGGCGTGGAAGTTTGCAGAGGAGAACGGGCTGGATGTGGTTGTGGTTAACCCGGGGACTGTGCTGGGCCCGATGATTCCACCAGCCATCAACGCTAGCATGGCCATGTTTTGTCGCCTCCTTCAAGGCTGCACGGAGGAGTACGCCGATTTCTTCCTAGGGCCAGTGCACGTGGAAGACGTCGCCATGGCGCATATCCTGGTGTTCGAGAGCGCATCGGCGTCGGGGAGGCACCTGTGCGTCCACTCCATCTGCCACTGGAGCGACTTCGCCGCCAAAGTCGCCGAGCTCTACCCCGACTACAAAGTGCCCAAGTTCCCCATGGACACCCAGCCTGGGCTGGTGAGACAGGAGGTGGGGTCCAAGAAGCTCACCGCGCTGGGGCTTCAGATCACCCCCATGGAGAAGATCATCAGGGATGCCGTCGAGAGCCTCAAGAGCCGAGGCCACATCTCCTGAATCCTGATGGATGGCAGGATGGGCAGTGCTTGTGATGCGTGAGGCCGTACGTCATGGACCTTGCTAAGTTGCTAGCGTGGCTTGTGTAACTAGTTGTAATAAATAATGATGTCACCAGACGACGACGACGAACCTGAGAAGGAAAATTGAGCTAATAGCTCGATTTTCAGTTCTTAATCACGAAGTTTCAGGTACCGAACTGGATTGGATTCTTTGTCGCAGATGAGGCCTAGAGACACACGCTGAACGTTCTGATAGTTGCCGTCAACTGTACTTGGCCACGCCATTTGCTCCTCCTCTTCTTTGGCCTGCACTCTGCACAAAGTTCAGTAATGTGCTTTGGTGCAGGATCATGAGCAACTGTATACAGATTTTTTGGGGGTGCAAAACAGTGAAGCACCCTCTAAAGCCTTTCGTTCGGTTGTACGTGGATCGGAAGTGGTTGAGAGT


Protein sequences

Name Description Sequence
Zm.67039 translated coding region predicted by ESTScan from UniGene Zm.67039

XGRNLSSEDRKNGRRRDGKRGRRQGRDGAGHRGQRLHRFDPRPRPPRPRLQRPRRRPRPRSVEYSSPSPALSAGFASSPPEQXVAMNNDAGRESCWPLARLRRGARSAHRVRRGGVHADDRAETDHLLALAAGAGRLSFFRCDLLDGAALLDAARGCSGVFHLASPCTVDPVKDPQNQLMVPAVEGTLNVVRAAKDAGGVRRVVVTSSISAVVPNPGWPAGEVVDERCWTDIDYCEKNGVWYPASKTLAEKAAWKFAEENGLDVVVVNPGTVLGPMIPPAINASMAMFCRLLQGCTEEYADFFLGPVHVEDVAMAHILVFESASASGRHLCVHSICHWSDFAAKVAELYPDYKVPKFPMDTQPGLVRQEVGSKKLTALGLQITPMEKIIRDAVESLKSRGHISXILMDGRMGSACDA

Domains

Domain Start-End Description Sequence

Seg: seg
10-35 seg

RKNGRRRDGKRGRRQGRDGAGHRGQR

Seg: seg
41-60 seg

PRPRPPRPRLQRPRRRPRPR

Seg: seg
98-117 seg

LARLRRGARSAHRVRRGGVH

HMMPanther: PTHR10366:SF9
101-408 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

LRRGARSAHRVRRGGVHADDRAETDHLLALAAGAGRLSFFRCDLLDGAALLDAARGCSGVFHLASPCTVDPVKDPQNQLMVPAVEGTLNVVRAAKDAGGVRRVVVTSSISAVVPNPGWPAGEVVDERCWTDIDYCEKNGVWYPASKTLAEKAAWKFAEENGLDVVVVNPGTVLGPMIPPAINASMAMFCRLLQGCTEEYADFFLGPVHVEDVAMAHILVFESASASGRHLCVHSICHWSDFAAKVAELYPDYKVPKFPMDTQPGLVRQEVGSKKLTALGLQITPMEKIIRDAVESLKSRGHISXILMD

HMMPanther: PTHR10366
101-408 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

LRRGARSAHRVRRGGVHADDRAETDHLLALAAGAGRLSFFRCDLLDGAALLDAARGCSGVFHLASPCTVDPVKDPQNQLMVPAVEGTLNVVRAAKDAGGVRRVVVTSSISAVVPNPGWPAGEVVDERCWTDIDYCEKNGVWYPASKTLAEKAAWKFAEENGLDVVVVNPGTVLGPMIPPAINASMAMFCRLLQGCTEEYADFFLGPVHVEDVAMAHILVFESASASGRHLCVHSICHWSDFAAKVAELYPDYKVPKFPMDTQPGLVRQEVGSKKLTALGLQITPMEKIIRDAVESLKSRGHISXILMD

superfamily: SSF51735
109-398 NAD(P)-binding Rossmann-fold domains

HRVRRGGVHADDRAETDHLLALAAGAGRLSFFRCDLLDGAALLDAARGCSGVFHLASPCTVDPVKDPQNQLMVPAVEGTLNVVRAAKDAGGVRRVVVTSSISAVVPNPGWPAGEVVDERCWTDIDYCEKNGVWYPASKTLAEKAAWKFAEENGLDVVVVNPGTVLGPMIPPAINASMAMFCRLLQGCTEEYADFFLGPVHVEDVAMAHILVFESASASGRHLCVHSICHWSDFAAKVAELYPDYKVPKFPMDTQPGLVRQEVGSKKLTALGLQITPMEKIIRDAVESLKS

Gene3D: G3DSA:3.40.50.720
IPR016040
120-294 no description
NAD(P)-binding domain

DRAETDHLLALAAGAGRLSFFRCDLLDGAALLDAARGCSGVFHLASPCTVDPVKDPQNQLMVPAVEGTLNVVRAAKDAGGVRRVVVTSSISAVVPNPGWPAGEVVDERCWTDIDYCEKNGVWYPASKTLAEKAAWKFAEENGLDVVVVNPGTVLGPMIPPAINASMAMFCRLLQG

Seg: seg
127-137 seg

LLALAAGAGRL

HMMPfam: PF01370
IPR001509
129-329 Epimerase
NAD-dependent epimerase/dehydratase

ALAAGAGRLSFFRCDLLDGAALLDAARGCSGVFHLASPCTVDPVKDPQNQLMVPAVEGTLNVVRAAKDAGGVRRVVVTSSISAVVPNPGWPAGEVVDERCWTDIDYCEKNGVWYPASKTLAEKAAWKFAEENGLDVVVVNPGTVLGPMIPPAINASMAMFCRLLQGCTEEYADFFLGPVHVEDVAMAHILVFESASASGRH

Seg: seg
143-154 seg

DLLDGAALLDAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox