PRGDB00064255 (Zm.67511)

From PRG Wiki
Jump to: navigation, search
Zm.67511
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223943598 (BT061186)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0120F21 mRNA, complete cds

DNA Sequence

GTAACATACCATCAAGTTTCAGCAGGTGTGTAAAAATTGCTGAGATAAACTGGTCAGAGAACAATATTTTTGGGGCAATACCACCAGAAATTGGAAAGTTGGTGAATCTGAAAAGGCTTGACCTCTCACACAATCTATTGCATGGTTCGATCCCTGTGCAAATTTCTAGTTGCTCCAAGTTGTATTCACTTGATTTGGGTTTTAACTCTTTGAATGGTTCGGCCCTCAGCACAGTAAGCAGCCTGAAGTTTCTGACACAGCTACGATTGCAAGAGAATAGATTCAGCGGAGGTTTGCCTGATCCTTTCTCACAATTGGAAATGCTTATTGAGCTGCAACTTGGTGGAAATATTCTTGGGGGCAGTATCCCTTCATCATTAGGACAGCTGGTGAAACTGGGTACAACCTTGAACCTTAGTAGCAATGGTCTAGTGGGTGACATTCCATCACAATTCGGTAATTTGGTGGAGTTGCAAAACTTAGATTTGTCATTTAATAATCTCACAGGAGGCCTTGCTACATTGCGAAGTCTACGCTTTTTGCAGGCCTTGAATGTTTCTTACAACCAATTTAGTGGACCAGTTCCAGATAATCTTGTGAAGTTTCTGAGTTCCACAACAAATTCTTTTGATGGAAACCCAGGCCTCTGTATCTCTTGCAGCACCAGTGATTCTTCTTGCATGGGAGCTAATGTTCTGAAACCTTGTGGCGGGTCAAAGAAAAGAGCAGTGCATGGCCGATTCAAAATTGTTCTCATAGTTCTTGGCTCATTATTTGTGGGAGCAGTTCTGGTACTCATACTCTGGTGCATCCTTCTGAAATCTCGAGATCAGAAGAAGAATAGTGAGGAAGCAGTCAGTCATATGTTTGAAGGTTCCTCATCTAAATTAAATGAGGTTATAGAGGCAACTGAATGTTTTGATGACAAGTATATCATTGGTAAAGGTGGTCACGGAACCGTTTACAAGGCAACACTGAGGTCAGGGGATGTTTATGCTATAAAGAAACTTGTGATTTCTGCACACAAAGGTTCATACAAAAGCATGGTTGGAGAACTGAAGACACTAGGTAAAATCAAGCACAGGAACTTGATTAAGCTGAAAGAATCTTGGTTGAGAAATGACAATGGATTCATACTGTATGATTTTATGGAAAAAGGTAGCCTTCATGATGTTCTACATGTAGTTCAGCCAGCACCAGCCTTAGACTGGTGTGTGCGGTATGACATAGCCCTCGGCACTGCCCATGGGTTAGCATATCTACATGATGACTGCCGCCCTGCGATCATTCATCGCGACATCAAGCCAAGTAATATACTGCTGGACAAGGACATGGTGCCACATATTTCAGATTTTGGCATTGCAAAGCTCTTGGAGCAGCCTTCTACTGCTCCTCAGACCACTGGTGTTGTTGGCACCATTGGATATATGGCCCCAGAGTTAGCGTTCTCCACCAAGAGCAGCATGGAGTCCGACGTGTACAGCTACGGCGTGGTGCTGCTGGAGCTGCTCACGAGGAGGGCGGCGGTGGATCCCTCGTTTCCCGACGGCACGGACATAGTCAGCTGGGCGTCGTCCGCCCTGAACGGCACTGACAAAATCGAGGCCGTCTGCGACCCGGCCCTCATGGAGGAAGTCTTCGGCACGGTGGAGATGGAGGAGGTGAGTAAGGTCCTGTCAGTGGCGCTGCGGTGCGCGGCCAGGGAGGCGAGCCAAAGGCCCTCCATGACCGCGGTCGTGAAGGAGCTGACGGATGCACGGCCTGCCACTGGCGGCGGCCGGTCGTTGTCCAAGTCGAAGCAGGGGAAACCAGGATCGCAATCCAACAGCAGCGCCTACCGGCAGTAGGATCTCTGACTCTGCCGAGCTGTTTGGGGACACCAACTTTACTCAACTTTAGTCTCTACTCTATAGGTACCCTCGCTTGGTGTACATCCTGATTGGTTAGTTGGCAAAGATTAGTTGTAGTTCAAATGAAACGGAGAGATGCTGGACTCGTGTCAGTGCGAGTGAAGCAAGCTGCTTGTTCTGAAATCTGTGGACTGTGGCTTGTCCGTGGCTTCCAGGGACGGGACCAGGATAGAATGGGTATTCCAAATTGTACT


Protein sequences

Name Description Sequence
Zm.67511 translated coding region predicted by ESTScan from UniGene Zm.67511

XNIPSSFSRCVKIAEINWSENNIFGAIPPEIGKLVNLKRLDLSHNLLHGSIPVQISSCSKLYSLDLGFNSLNGSALSTVSSLKFLTQLRLQENRFSGGLPDPFSQLEMLIELQLGGNILGGSIPSSLGQLVKLGTTLNLSSNGLVGDIPSQFGNLVELQNLDLSFNNLTGGLATLRSLRFLQALNVSYNQFSGPVPDNLVKFLSSTTNSFDGNPGLCISCSTSDSSCMGANVLKPCGGSKKRAVHGRFKIVLIVLGSLFVGAVLVLILWCILLKSRDQKKNSEEAVSHMFEGSSSKLNEVIEATECFDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVDPSFPDGTDIVSWASSALNGTDKIEAVCDPALMEEVFGTVEMEEVSXGPVSGAAVRGQGGEPKALHDRGREGADGCTACHWRRPVVVQVEAGETRIAIQQQRLPAVGSLTLPSCLGTPTLLNFSLYSIGTLAWCTSXLVSWQRLVVVQMKRRDAGLVSVRVKQAACSEICGLWLVRGFQGRDQDRMGIPNCT

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
3-216 no description

IPSSFSRCVKIAEINWSENNIFGAIPPEIGKLVNLKRLDLSHNLLHGSIPVQISSCSKLYSLDLGFNSLNGSALSTVSSLKFLTQLRLQENRFSGGLPDPFSQLEMLIELQLGGNILGGSIPSSLGQLVKLGTTLNLSSNGLVGDIPSQFGNLVELQNLDLSFNNLTGGLATLRSLRFLQALNVSYNQFSGPVPDNLVKFLSSTTNSFDGNPGL

superfamily: SSF52058
3-217 L domain-like,LRR

IPSSFSRCVKIAEINWSENNIFGAIPPEIGKLVNLKRLDLSHNLLHGSIPVQISSCSKLYSLDLGFNSLNGSALSTVSSLKFLTQLRLQENRFSGGLPDPFSQLEMLIELQLGGNILGGSIPSSLGQLVKLGTTLNLSSNGLVGDIPSQFGNLVELQNLDLSFNNLTGGLATLRSLRFLQALNVSYNQFSGPVPDNLVKFLSSTTNSFDGNPGLC

HMMPanther: PTHR24420
3-556 FAMILY NOT NAMED,FAMILY NOT NAMED

IPSSFSRCVKIAEINWSENNIFGAIPPEIGKLVNLKRLDLSHNLLHGSIPVQISSCSKLYSLDLGFNSLNGSALSTVSSLKFLTQLRLQENRFSGGLPDPFSQLEMLIELQLGGNILGGSIPSSLGQLVKLGTTLNLSSNGLVGDIPSQFGNLVELQNLDLSFNNLTGGLATLRSLRFLQALNVSYNQFSGPVPDNLVKFLSSTTNSFDGNPGLCISCSTSDSSCMGANVLKPCGGSKKRAVHGRFKIVLIVLGSLFVGAVLVLILWCILLKSRDQKKNSEEAVSHMFEGSSSKLNEVIEATECFDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVDPSFPDGTDIVSWASSALNGTDKIEAVCDPALMEEVFGTVEMEEVS

HMMPanther: PTHR24420:SF471
3-556 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IPSSFSRCVKIAEINWSENNIFGAIPPEIGKLVNLKRLDLSHNLLHGSIPVQISSCSKLYSLDLGFNSLNGSALSTVSSLKFLTQLRLQENRFSGGLPDPFSQLEMLIELQLGGNILGGSIPSSLGQLVKLGTTLNLSSNGLVGDIPSQFGNLVELQNLDLSFNNLTGGLATLRSLRFLQALNVSYNQFSGPVPDNLVKFLSSTTNSFDGNPGLCISCSTSDSSCMGANVLKPCGGSKKRAVHGRFKIVLIVLGSLFVGAVLVLILWCILLKSRDQKKNSEEAVSHMFEGSSSKLNEVIEATECFDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVDPSFPDGTDIVSWASSALNGTDKIEAVCDPALMEEVFGTVEMEEVS

HMMPfam: PF00560
IPR001611
36-58 LRR_1
Leucine-rich repeat

NLKRLDLSHNLLHGSIPVQISSC

HMMPfam: PF00560
IPR001611
135-155 LRR_1
Leucine-rich repeat

TTLNLSSNGLVGDIPSQFGNL

HMMPfam: PF13516
158-170 LRR_6,Leucine Rich repeat

LQNLDLSFNNLTG

superfamily: SSF56112
IPR011009
279-511 Protein kinase-like (PK-like)
Protein kinase-like domain

KKNSEEAVSHMFEGSSSKLNEVIEATECFDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVD

Gene3D: G3DSA:3.30.200.20
299-390 no description

EVIEATECFDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLH

ProfileScan: PS50011
IPR000719
307-561 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVDPSFPDGTDIVSWASSALNGTDKIEAVCDPALMEEVFGTVEMEEVSXGPVS

HMMSmart: SM00219
IPR020635
307-568 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVDPSFPDGTDIVSWASSALNGTDKIEAVCDPALMEEVFGTVEMEEVSXGPVSGAAVRGQ

HMMSmart: SM00220
IPR002290
307-607 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDDKYIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVDPSFPDGTDIVSWASSALNGTDKIEAVCDPALMEEVFGTVEMEEVSXGPVSGAAVRGQGGEPKALHDRGREGADGCTACHWRRPVVVQVEAGETRIA

HMMPfam: PF00069
IPR017442
311-511 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YIIGKGGHGTVYKATLRSGDVYAIKKLVISAHKGSYKSMVGELKTLGKIKHRNLIKLKESWLRNDNGFILYDFMEKGSLHDVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVD

PatternScan: PS00107
IPR017441
313-336 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGHGTVYKATLRSGDVYAIKK

Gene3D: G3DSA:1.10.510.10
391-511 no description

DVLHVVQPAPALDWCVRYDIALGTAHGLAYLHDDCRPAIIHRDIKPSNILLDKDMVPHISDFGIAKLLEQPSTAPQTTGVVGTIGYMAPELAFSTKSSMESDVYSYGVVLLELLTRRAAVD

PatternScan: PS00108
IPR008271
429-441 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox