PRGDB00064257 (Zm.67813)

From PRG Wiki
Jump to: navigation, search
Zm.67813
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224032252 (BT068305)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0100E12 mRNA, complete cds

DNA Sequence

GGCGACTGGGCAGTTCAGCTACTTCAATGCCACATCCTTCGTCGGCAACCCGGGGTTGTGTGGGCCGTACCTTGGACCATGCCATTCTGGCGGCGCCGGCACGGGCCATGATGCACACACCTATGGCGGCATGTCCAATACCTTCAAGCTGCTAATCGTCCTCGGCTTACTTGTCTGCTCCATTGCGTTTGCTGCCATGGCGATCTTGGAAGAAAGCCAGCGAGGCACGCGCTTGGAGGCTCACTGCGTTCCAGCGCCTCGAGTTCACCTGCGACGACGTGCTAGACAGTCTGAAGGAGGAGAACATCATCGGCAAAGGTGGAGCCGGGATCGTGTACAAGGGGACGATGCCGGACGGTGAGCATGTCGCAGTGAAGCGGCTTTCGTCGATGAGCCGTGGCTCGTCACACGACCACGGGTTCTCTGCAGAGATACAAACCCTCGGGAGGATCCGACACCGCTACATCGTGAGGTTGCTCGGCTTCTGCTCGAACAACGAGACGAATCTCCTGGTGTACGAGTTCATGCCCAACGGGAGCCTGGGGGAGCTGCTCCATGGCAAGAAAGGTGGCCATCTCCACTGGGACACTCGCTACAAGATCGCCGTCGAGGCCGCCAAGGGGCTCAGCTACCTGCACCACGATTGCTCGCCGCCGATCCTGCACCGCGATGTTAAATCGAACAACATCCTGCTTGATTCCGATTTCGAAGCACACGTTGCTGATTTCGGGCTCGCCAAGTTCTTGCAGGACTCTGGCGCATCACAGTGTATGTCTGCCATTGCTGGCTCCTATGGCTATATTGCCCCAGAGTACGCATACACCCTCAAGGTGGACGAGAAGAGCGACGTGTACAGCTTCGGCGTGGTGCTCCTGGAGCTGGTAACGGGAAAGAAGCCGGTAGGCGAGTTCGGGGACGGCGTGGACATCGTCCACTGGGTCAGGTCGACGACGGCGGGCGCGAGCAAGGAGCAGGTGGTCAAGGTCATGGACCCCAGGCTGTCGAGCGTGCCGGTGCACGAGGTGGCGCACGTGTTCTGCGTCGCGCTCCTCTGCGTGGAGGAGCAGAGCGTGCAGCGCCCCACGATGCGGGAGGTGGTGCAGATGCTCGGCGAGCTCCCCAAGCCAGCCGCTGCCGCTGCAGCTGCAGGGCAAGGAGACGAGGTTCCCGGCAGCGGCGACGGCGACGAATGTTCCGCCGCGCCGTCGGGTGCTCCGGCAGCTGATGAATCTGTTGAAGCGCCGCATGGCGAAGCCACCAAAGAACCGAGCTCACAGTCTTCGCCGACCACTGATCTCATCAGCATCTGAGAGCTGTGTCGAGCTTGtttttttttCTTCTCGTTGCTATGTTTCCTTCCTTCTCCTTGCGAAGTTCAGATGTTTGGATGTTTCTAGATTATTAGGGTTTGGTGTTTTAGGTCTCACCTGCACTTAGGGTGGTCTCTGAGATTCAGACATCTTGTGTTCATCCATCTTCATTTAGGTAGGCCCCGGGATTCAGACATCTTGTGTTCATCCATCTTGTGTTCATGCATCTTAGCCTCACTTAGGACACTGCTGTGTACAGTAGTACATATCAAGCTCCCTAAATCTCCATTTTGCTGTCAGAACTGAAGGACCATTTAGGGGGGGATTAAGGAGCCTAGGATTATGGAGCAGTCAAGGTCGTTAATGTTGCTGTTTGTACTTGTGTTAATAAGGTGGGCATTGAT


Protein sequences

Name Description Sequence
Zm.67813 translated coding region predicted by ESTScan from UniGene Zm.67813

XATGQFSYFNATSFVGNPGLCGPYLGPCHSGGAGTGHDAHTYGGMSNTFKLLIVLGLLVCSIAFAAMAILEESSEARAWRLTAFQRLEFTCDDVLDSLKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPKPAAAAAAAGQGDEVPGSGDGDECSAAPSGAPAADESVEAPHGEATKEPSSQSSPTTDLISI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF462
5-392 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QFSYFNATSFVGNPGLCGPYLGPCHSGGAGTGHDAHTYGGMSNTFKLLIVLGLLVCSIAFAAMAILEESSEARAWRLTAFQRLEFTCDDVLDSLKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPKPAAAAAAAGQGDEVPGS

HMMPanther: PTHR24420
5-392 FAMILY NOT NAMED,FAMILY NOT NAMED

QFSYFNATSFVGNPGLCGPYLGPCHSGGAGTGHDAHTYGGMSNTFKLLIVLGLLVCSIAFAAMAILEESSEARAWRLTAFQRLEFTCDDVLDSLKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPKPAAAAAAAGQGDEVPGS

superfamily: SSF56112
IPR011009
70-370 Protein kinase-like (PK-like)
Protein kinase-like domain

LEESSEARAWRLTAFQRLEFTCDDVLDSLKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQML

Gene3D: G3DSA:2.60.120.200
IPR013320
70-117 no description
Concanavalin A-like lectin/glucanase, subgroup

LEESSEARAWRLTAFQRLEFTCDDVLDSLKEENIIGKGGAGIVYKGTM

ProfileScan: PS50011
IPR000719
98-378 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPKPAA

HMMSmart: SM00220
IPR002290
98-370 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQML

HMMSmart: SM00219
IPR020635
98-370 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKEENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQML

HMMPfam: PF00069
IPR017442
100-368 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EENIIGKGGAGIVYKGTMPDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQ

Gene3D: G3DSA:3.30.200.20
118-162 no description

PDGEHVAVKRLSSMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGF

Gene3D: G3DSA:1.10.510.10
163-369 no description

CSNNETNLLVYEFMPNGSLGELLHGKKGGHLHWDTRYKIAVEAAKGLSYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQM

Seg: seg
181-194 seg

LGELLHGKKGGHLH

PatternScan: PS00108
IPR008271
220-232 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHRDVKSNNILL

Seg: seg
377-383 seg

AAAAAAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox