PRGDB00064258 (Zm.68222)

From PRG Wiki
Jump to: navigation, search
Zm.68222
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195637547 (EU966124)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 291903 protein kinase APK1B mRNA, complete cds

DNA Sequence

AGAGGACGCGCACCCGGGGTGGAGCTGAGAGCAACAGGAGCTCCTGCGGCGAATTCGGGCCCCGAGTACGCCGGTTCAGGCGGCCGCCGCCGGTGGAATTGTGCCAGTCGAGGTGGCCTGCTGGTGCGGCGGGAGTTTGCGAGTAGGGCGGTTCCGGTTTTGAGTGAGCGAAGGTGTTGTTGGGGGCGTGGATCTGGCCGGCGGCGGGCGATGGGAAGGAGGGACTAGGGCTCGATTGGAGGGAAAGGCGTGATCCATGGGCGGATGCTTCTCGCAGGAGGAGCACCGGCTCCAGAGCAGGCCAGCTGAAGCTGCTGGACCAGACGGACTGCAGAAGTCAAAATCTGATTCTAAAGCTACAGCAAGTGTTCTTGCTCCACCAAAAGCTGTGGTGGATCTGCAAGTGGAAGGATATGGAAATGTGAATATTTTCACATATGACGAATTGAGCGCAGCCACAAAAAACTTCCGACCAGATCAAATTCTTGGAGAGGGTGGGTTTGGAGTTGTTTACAAAGGTGTAATTGATGAAAATGTTAGAGCAGGTTTCCCATCCAGGCAGGTTGCTGTGAAAGAACTAAACCCAGAGGGTTTTCAAGGGGACAAGGAGTGGCTGGCAGAAGTCAACTATCTTGGGCAACTTAGTCATCCAAATCTTGTTGAACTGATTGGCTATTGCTGTGAGGGTTCACATAGACTGCTTGTGTATGAGTACATGGCTTGTGGAAGCCTCGAAAAGCACCTTTTTCGGCGGGTTTGCCTTAATATGCCATGGTCAACACGCATGAAGATTGCATTGGGTGCTGCAAGGGGGCTCGAGTACCTTCACAGAGCTGAGAGATCCATCATTTATCGAGATTTCAAGACATCAAACATCTTGCTAGATGCGGATTATAATGCTAAGCTTTCAGACTTTGGTCTCGCAAGAACAGGTCCTAGTGGAGACCAAACCCACGTGTCAACTCGTGTTATGGGAACTTATGGATACGCGGCTCCAGAATATGTCATGACTGGCCATCTGACAGCACGAAGTGATGTTTATGGCTTTGGAGTCGTGCTTCTAGAGATGATTATTGGAAGAAGGGCTGTGGACGATAGCCGGCCGAGCCGTGAGCATAACCTAGTTGACTGGGCACGGCCCCTCCTCGTCCATAACAGGAAGCTGTTCCGGATAATCGATCCAAGAATGGAAGGGCAGTACTCCACCAAGGCTGCCACCGAGGTGGCAAGCCTTGCATACCGCTGCCTGAGCCAGAACCCCAAAGGACGACCAACCATGAGCCAAGTTGTTGAGACCTTTGAGGCCGTGCAGAACATGCCTGAATGCCAGGACATACTCCTCCAGAACGGCATCACAGGTGCCGTGACGCTCTACGAGGTCCCAAAGGAGCCTGCAGACAGAGTTGAGCTGGAGAAGGCCAAGCAGGAACCGGCAGTAAAGACCGCCGCAATCCCGCCCGTGAACGGAAAGCCGGCCCCCCAGAGCAGGCGAACGCGGCCTGGGAATGGCCGGAGCAAGAGCGAGCCATCGTTGGAGTGTAAGATGTACATCCCATCACCAGACTCTGACGAACAGCAGCTCGGCCTGGAGGCACTGGCGTCCCCAAATGGCAGCATGAAGGACCATCCTGATGAGGATTTGTACAAGATATAAAACCAGAGCCCTCGTTGCTCGCCTTTTGCGCCGCACACCCCAGTTCTCAAAGATCGGTCAGTTACAATTTTTTCTCTGATAGCCACCGGCCTCGCTAGGGTTCTTATTCTTCCGATTAGCAATAGTATGTAGAGGGAGAGTTGTGATGGAAAGCATGTGTGTGCTTGCCATGACGATGCTGTAGAGATCTGATACACTTCTTTCTGGGGAATTTCCACTCCAAAAATGGAAGTTGAGAGATGTGTCCTGACGATTGGTGCGTTTTACCCGTGTGTTGAGTTTACTTGTAAAGATGCTTCTTCGTTGTAATCTTCAGTTCTGCGGGAAATCAACACCAGCATAGAAATTGATAGATCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.68222 translated coding region predicted by ESTScan from UniGene Zm.68222

RGRAPGVELRATGAPAANSGPEYAGSGGRRRWNCASRGGLLVRREFASRAVPVLSEEGVVGGVDLAGGGRWEGGTRARLEGKAXSMGGCFSQEEHRLQSRPAEAAGPDGLQKSKSDSKATASVLAPPKAVVDLQVEGYGNVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETFEAVQNMPECQDILLQNGITGAVTLYEVPKEPADRVELEKAKQEPAVKTAAIPPVNGKPAPQSRRTRPGNGRSKSEPSLECKMYIPSPDSDEQQLGLEALASPNGSMKDHPDEDLYKI

Domains

Domain Start-End Description Sequence

Seg: seg
58-69 seg

GVVGGVDLAGGG

superfamily: SSF56112
IPR011009
126-441 Protein kinase-like (PK-like)
Protein kinase-like domain

PPKAVVDLQVEGYGNVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETFEAVQNMPE

HMMPanther: PTHR24420:SF529
126-517 SUBFAMILY NOT NAMED

PPKAVVDLQVEGYGNVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETFEAVQNMPECQDILLQNGITGAVTLYEVPKEPADRVELEKAKQEPAVKTAAIPPVNGKPAPQSRRTRPGNGRSKSEPSLECKMYI

HMMPanther: PTHR24420
126-517 FAMILY NOT NAMED,FAMILY NOT NAMED

PPKAVVDLQVEGYGNVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETFEAVQNMPECQDILLQNGITGAVTLYEVPKEPADRVELEKAKQEPAVKTAAIPPVNGKPAPQSRRTRPGNGRSKSEPSLECKMYI

Gene3D: G3DSA:3.30.200.20
140-225 no description

NVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGY

ProfileScan: PS50011
IPR000719
156-436 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETFEAV

HMMSmart: SM00219
IPR020635
156-433 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETF

HMMSmart: SM00220
IPR002290
156-436 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVETFEAV

HMMPfam: PF00069
IPR017442
159-432 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DQILGEGGFGVVYKGVIDENVRAGFPSRQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIGYCCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVET

PatternScan: PS00107
IPR017441
162-191 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGVVYKGVIDENVRAGFPSRQVAVK

Gene3D: G3DSA:1.10.510.10
226-432 no description

CCEGSHRLLVYEYMACGSLEKHLFRRVCLNMPWSTRMKIALGAARGLEYLHRAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDDSRPSREHNLVDWARPLLVHNRKLFRIIDPRMEGQYSTKAATEVASLAYRCLSQNPKGRPTMSQVVET

PatternScan: PS00108
IPR008271
282-294 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox