PRGDB00064264 (Zm.74158)

From PRG Wiki
Jump to: navigation, search
Zm.74158
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195606947 (EU953186)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1389734 ATP binding protein mRNA, complete cds

DNA Sequence

GTCCTTCTTCCTTCTCTCACACACTCCACTCCACGTCCCCCTCCTTCAAATCCTTTCAACACCCAAGCACAAGGAGAGAGAAGCCGCCGCCGCCGCCATGGACAATATTGAGGTGAGGAGGAGGAAGAAGAAAGGGAGAAGCAGCGGACGCCGCCAGGGGGGACGGGTACAGGCGGTCCTGCGCGCCGGCCTCGTCGCCATGGCCTTCGCCCTCCTCTGCCTCTGCTCCTCCACGCCCTCCGCCATTGCCCTCACCCCAGACGGCGAGGCGTTGCTGGAGCTCAAGCTGGCCTTCAACGCCACCGTGCAGCGGCTCACCAGCTGGCGTCCCAGCGACCCCAACCCCTGCGGCTGGGAGGGCATCTCCTGCTCCGTCCCTGACCTCAGGGTCCAATCCATAAACCTCCCATTCATGCAGCTCGGGGGCATCATTTCGCCCAGCATCGGGAGGCTCGACAAGCTGCAGAGACTAGCTCTGCACCAGAACAGCTTGCACGGCCCAATCCCTGCAGAGATCAAGAACTGCACCGAGCTCAGGGCAATTTACCTGAGAGCCAACTACCTGCAAGGAGGCATCCCTTCAGAGATTGGCGAGCTCGTGCACCTCACCATCTTGGACCTGTCAAGCAATCTGCTGAGGGGCACAATACCGGCCTCGATCGGAAGCCTCACTCACCTGCGCTTTCTGAACCTGTCTACTAACTTCTTCTCCGGAGAGATCCCAAATGCTGGTGTCCTCGGAACCTTCAAAAGCAGCTCGTTCGTTGGAAATCTGGAGCTCTGTGGCCTGTCCATCCAGAAAGCTTGCCGTGGAACCCTCGGCTTTCCTGCTGTGTTGCCACATTCCGATCCGCTCTCTTCGGCTGGTGTTTCTCCAATCAATAACAACAAGACGTCACACTTTCTCAATGGCGTCGTGATCGGCTCGATGTCAACCTTGGCTCTTGCCTTGGTAGCCGTACTTGGGTTCCTATGGATCTGCTTGCTGTCCMTTAAGAGTAGCATTGGTGGAAACTATGAGAAGATGGACAAACAGACTGTACCTGATGGTGCAAAGCTTGTGACATACCAGTGGARCCTTCCATATTCATCAAGCGAGATTATTAGAAGGTTGGAGCTGCTTGATGAAGAGGACGTGGTCGGTTGTGGGGGCTTTGGCACGGTGTACAGGATGGTGATGGATGATGGCACGTCGTTTGCCGTCAAGAGGATTGACCTCAGCCGCGAAAGTCGCGACAGGACCTTCGAGAAGGAGCTTGAGATTCTGGGCAGCATCAGGCACATAAACCTTGTCAATCTGCGAGGCTACTGCCGGCTCCCCACAGCGAAGCTACTCGTATATGATTTCGTTGAGCTGGGCAGCTTGGATTGCTACCTTCATGGAGATGAACAAGAGGAGCAGCCATTGAACTGGAACGCGCGGATGAAAATCGCGCTTGGCTCGGCTCGAGGCCTGGCATATCTGCACCACGATTGCTCGCCCGGGATCGTGCATAGGGACATCAAAGCCAGTAACATCCTGCTGGATAGAAGCTTGGAGCCTCGTGTCTCCGATTTTGGCCTCGCGAGGCTGCTTGTAGACAGTGCTGCCCACGTTACCACCGTCGTCGCGGGCACCTTTGGATACCTAGCACCAGAGTACTTGCAAAACGGGCATGCTACTGAGAAATCAGACGTGTATAGCTTTGGAGTGCTTATGCTGGAGCTAGTGACCGGAAAGAGGCCGACCGATTCTTGCTTCATCAAGAAGGGACTGAACATTGTTGGCTGGCTCAACACCCTAACTGGGGAGCACCGGCTGGAGGATATCATCGATGAGCGATGCGGCGATGTGGAGGTGGAAGCCGTGGAAGCCATCCTGGACATCGCAGCCATGTGCACCGACGCAGACCCGGGGCAGCGGCCATCGATGAGCGCTGTCCTCAAGATGCTGGAGGAGGAGATCTTGTCCCCCTGCATGAGCGAGCTGTGCTACGAGCAGCACCTGGAGCTCTGAGCTGAGGAGGAAGATGGTGCTGGCTGCGTGCGTGAAGCGTCATGGATGAGACTGAAGTTTTGTACTGTAGATACAACGATGATGAGTGTAGGTGATGTACTGATGTTTTGTGTGCTCTTAGGGCCAATGAAGAACAGTAAGCAGCAGTTCGTGAGTGaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.74158 translated coding region predicted by ESTScan from UniGene Zm.74158

XSFFLLSHTPLHVPLLQILSTPKHKEREAAAAAMDNIEVRRRKKKGRSSGRRQGGRVQAVLRAGLVAMAFALLCLCSSTPSAIALTPDGEALLELKLAFNATVQRLTSWRPSDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPIPAEIKNCTELRAIYLRANYLQGGIPSEIGELVHLTILDLSSNLLRGTIPASIGSLTHLRFLNLSTNFFSGEIPNAGVLGTFKSSSFVGNLELCGLSIQKACRGTLGFPAVLPHSDPLSSAGVSPINNNKTSHFLNGVVIGSMSTLALALVAVLGFLWICLLSXKSSIGGNYEKMDKQTVPDGAKLVTYQWXLPYSSSEIIRRLELLDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKMLEEEILSPCMSELCYEQHLEL

Domains

Domain Start-End Description Sequence

Seg: seg
39-58 seg

VRRRKKKGRSSGRRQGGRVQ

HMMPanther: PTHR24420:SF873
48-652 SUBFAMILY NOT NAMED

SSGRRQGGRVQAVLRAGLVAMAFALLCLCSSTPSAIALTPDGEALLELKLAFNATVQRLTSWRPSDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPIPAEIKNCTELRAIYLRANYLQGGIPSEIGELVHLTILDLSSNLLRGTIPASIGSLTHLRFLNLSTNFFSGEIPNAGVLGTFKSSSFVGNLELCGLSIQKACRGTLGFPAVLPHSDPLSSAGVSPINNNKTSHFLNGVVIGSMSTLALALVAVLGFLWICLLSXKSSIGGNYEKMDKQTVPDGAKLVTYQWXLPYSSSEIIRRLELLDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKMLEEEILSP

HMMPanther: PTHR24420
48-652 FAMILY NOT NAMED,FAMILY NOT NAMED

SSGRRQGGRVQAVLRAGLVAMAFALLCLCSSTPSAIALTPDGEALLELKLAFNATVQRLTSWRPSDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPIPAEIKNCTELRAIYLRANYLQGGIPSEIGELVHLTILDLSSNLLRGTIPASIGSLTHLRFLNLSTNFFSGEIPNAGVLGTFKSSSFVGNLELCGLSIQKACRGTLGFPAVLPHSDPLSSAGVSPINNNKTSHFLNGVVIGSMSTLALALVAVLGFLWICLLSXKSSIGGNYEKMDKQTVPDGAKLVTYQWXLPYSSSEIIRRLELLDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKMLEEEILSP

superfamily: SSF52058
82-270 L domain-like,LRR

AIALTPDGEALLELKLAFNATVQRLTSWRPSDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPIPAEIKNCTELRAIYLRANYLQGGIPSEIGELVHLTILDLSSNLLRGTIPASIGSLTHLRFLNLSTNFFSGEIPNAGVLGTFKSSSFVGNLELCGLSIQKAC

HMMPfam: PF08263
IPR013210
87-125 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

PDGEALLELKLAFNATVQRLTSWRPSDPNPCGWEGISCS

HMMPfam: PF00560
IPR001611
202-224 LRR_1
Leucine-rich repeat

HLTILDLSSNLLRGTIPASIGSL

Seg: seg
314-322 seg

LALALVAVL

superfamily: SSF56112
IPR011009
345-645 Protein kinase-like (PK-like)
Protein kinase-like domain

KQTVPDGAKLVTYQWXLPYSSSEIIRRLELLDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKML

Seg: seg
367-381 seg

EIIRRLELLDEEDVV

ProfileScan: PS50011
IPR000719
375-650 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKMLEEEIL

HMMSmart: SM00220
IPR002290
375-654 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKMLEEEILSPCM

HMMSmart: SM00219
IPR020635
375-645 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LDEEDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKML

HMMPfam: PF00069
IPR017442
378-643 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EDVVGCGGFGTVYRMVMDDGTSFAVKRIDLSRESRDRTFEKELEILGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLK

PatternScan: PS00107
IPR017441
381-403 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGCGGFGTVYRMVMDDGTSFAVK

Gene3D: G3DSA:3.80.10.10
401-422 no description

AVKRIDLSRESRDRTFEKELEI

Gene3D: G3DSA:1.10.510.10
423-645 no description

LGSIRHINLVNLRGYCRLPTAKLLVYDFVELGSLDCYLHGDEQEEQPLNWNARMKIALGSARGLAYLHHDCSPGIVHRDIKASNILLDRSLEPRVSDFGLARLLVDSAAHVTTVVAGTFGYLAPEYLQNGHATEKSDVYSFGVLMLELVTGKRPTDSCFIKKGLNIVGWLNTLTGEHRLEDIIDERCGDVEVEAVEAILDIAAMCTDADPGQRPSMSAVLKML

PatternScan: PS00108
IPR008271
497-509 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox