PRGDB00064273 (Zm.77072)

From PRG Wiki
Jump to: navigation, search
Zm.77072
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195619407 (EU959416)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 218097 mRNA sequence

DNA Sequence

AAAAAGAGACCTGGGCAGGACGACACAGGCAGAGCCGCCGGCCCTCGCTTCTTGGTGGGGTCTAGTTTCTTTCTCGCCTCTGCCTGTGCCTGCTGGTGGTAAGTAATAACAGCGACACGGTACCCACGCACrgcggcggcggcggcgacgacgaagacgacatgaccgtcggcgacgacgcggcggcgCCGGGGCGGGGGCAGACGGTGTGCGTDACCGGCGCCGGCGGCTACGTCGGGTCGTGGATCGTCAAGCTCCTGCTCGAGCGGGGCTACGCCGTCCGCGGCACCGTGCGCAACCCTGACGACGCGAAGAACGCGCACCTGCTGGCGCTCCCCGGCGCGGCGGAGCGGCTGGCGCTGTGCAAGGCCGACCTGCTCGACTACGGCGCGCTAAGGGCGGCCGTCGCCGGCTGCCACARGCGTCTTCCACGCCGCGTCGCCGGTCACCGACGACCCGGAGGAGATGGTGGAGCCGGCGGTGCGGGGGACGCGGTACGTCATCGACGCGGCGGCCGAGGCCGGCACGGTCCGCCGCGTCGTCCTGACGTCGTCGATCGGCGCGGTGGCCATGGACCCCCGCCGCGAGCCGGACGCCGTCGTCGACGAGTCGTGCTGGAGCGACCTCGACTTCTGCAAGAAGACCAAGAACTGGTACTGCTacggcaaggcggcggcggagcgggcggcgtgggagrcggcggcggcgcgcggggtggacctggtggtggtggtgccggtgctggtgcAGGGCCCGGCGCTGCAGCCGTCGGTGAACGCCAGCCTGATGCACGTGCTCAAGTACCTGAACGGGTCCGCCAAGACGTACGCCAACGCGGTGCAGGCGTACGTGCACGTCCGCGACgccgccgacgcgcacgtccgcgtcttcgaggcgccccgcgccgccggccgctacatctgcgccgACGCCGTGCTCCACCGCGAGGACGTCGTCCGCACCCTCCGCAAGTCCTTCCCGGGCTACCCGGTCCCGGAGAGGTGCTCTGACGAGGTGAACCCGAGGAAGCAGCCGTACAAGATCTCCAACCAGCGGCTGAGGGAGCTGGGCCTGGAGTTCACCCCGGCGGCGCAGGCGCTGTACGACACCGTCGTGTGCTTCCAGGAGAAGGGCATCCTCCCTCTCCYTGTCCCCGCCCCAACGCCGGCGTCACCGGACGCCTGAGCTAGCTGATGAGCTGGCCCAGAACCAACGAAGAAACATGTTTGGCACGCAAACBGCTATTATAACAGTCGCTGCTTCGATCATTCTGCCGCTAGAGATAGAATGTGGAGTGTGTGCTACTCGTTGTGGGCGTAAGAGTGTCAGAAGAGTGCAGCAGTAACTATATCGATGCGACTTTTTATATGTTGCTATATCATGTGTGACAATCTCCTAATAATAAATATATGGAGTATCGTCCTATaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.77072 translated coding region predicted by ESTScan from UniGene Zm.77072

XKRDLGRTTQAEPPALASWWGLVSFSPLPVPAGGSNNSDTVPTHXGGGGDDEDDMTVGDDAAAPGRGQTVCVTGAGGYVGSWIVKLLLERGYAVRGTVRNPDDAKNAHLLALPGAAERLALCKADLLDYGALRAAVAGCHXRLPRRVAGHRRPGGDGGAGGAGDAVRHRRGGRGRHGPPRRPDVVDRRGGHGPPPRAGRRRRRVVLERPRLLQEDQELVLLRQGGGGAGGVGXGGGARGGPGGGGAGAGAGPGAAAVGERQPDARAQVPERVRQDDANAVQAYVHVRDAADAHVRVFEAPRAAGRYICADAVLHREDVVRTLRKSFPGYPVPERCSDEVNPRKQPYKISNQRLRELGLEFTPAAQALYDTVVCFQEKGILPLXVPAPTPASPDA

Domains

Domain Start-End Description Sequence

Seg: seg
45-60 seg

XGGGGDDEDDMTVGDD

HMMPanther: PTHR10366:SF9
52-387 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

EDDMTVGDDAAAPGRGQTVCVTGAGGYVGSWIVKLLLERGYAVRGTVRNPDDAKNAHLLALPGAAERLALCKADLLDYGALRAAVAGCHXRLPRRVAGHRRPGGDGGAGGAGDAVRHRRGGRGRHGPPRRPDVVDRRGGHGPPPRAGRRRRRVVLERPRLLQEDQELVLLRQGGGGAGGVGXGGGARGGPGGGGAGAGAGPGAAAVGERQPDARAQVPERVRQDDANAVQAYVHVRDAADAHVRVFEAPRAAGRYICADAVLHREDVVRTLRKSFPGYPVPERCSDEVNPRKQPYKISNQRLRELGLEFTPAAQALYDTVVCFQEKGILPLXVPAP

HMMPanther: PTHR10366
52-387 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

EDDMTVGDDAAAPGRGQTVCVTGAGGYVGSWIVKLLLERGYAVRGTVRNPDDAKNAHLLALPGAAERLALCKADLLDYGALRAAVAGCHXRLPRRVAGHRRPGGDGGAGGAGDAVRHRRGGRGRHGPPRRPDVVDRRGGHGPPPRAGRRRRRVVLERPRLLQEDQELVLLRQGGGGAGGVGXGGGARGGPGGGGAGAGAGPGAAAVGERQPDARAQVPERVRQDDANAVQAYVHVRDAADAHVRVFEAPRAAGRYICADAVLHREDVVRTLRKSFPGYPVPERCSDEVNPRKQPYKISNQRLRELGLEFTPAAQALYDTVVCFQEKGILPLXVPAP

superfamily: SSF51735
67-140 NAD(P)-binding Rossmann-fold domains

GQTVCVTGAGGYVGSWIVKLLLERGYAVRGTVRNPDDAKNAHLLALPGAAERLALCKADLLDYGALRAAVAGCH

Gene3D: G3DSA:3.40.50.720
IPR016040
68-139 no description
NAD(P)-binding domain

QTVCVTGAGGYVGSWIVKLLLERGYAVRGTVRNPDDAKNAHLLALPGAAERLALCKADLLDYGALRAAVAGC

HMMPfam: PF01370
IPR001509
70-139 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGYVGSWIVKLLLERGYAVRGTVRNPDDAKNAHLLALPGAAERLALCKADLLDYGALRAAVAGC

Seg: seg
147-210 seg

VAGHRRPGGDGGAGGAGDAVRHRRGGRGRHGPPRRPDVVDRRGGHGPPPRAGRRRRRVVLERPR

Seg: seg
224-258 seg

GGGGAGGVGXGGGARGGPGGGGAGAGAGPGAAAVG

superfamily: SSF51735
251-376 NAD(P)-binding Rossmann-fold domains

GPGAAAVGERQPDARAQVPERVRQDDANAVQAYVHVRDAADAHVRVFEAPRAAGRYICADAVLHREDVVRTLRKSFPGYPVPERCSDEVNPRKQPYKISNQRLRELGLEFTPAAQALYDTVVCFQE

Gene3D: G3DSA:3.40.50.720
IPR016040
265-326 no description
NAD(P)-binding domain

RAQVPERVRQDDANAVQAYVHVRDAADAHVRVFEAPRAAGRYICADAVLHREDVVRTLRKSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox