PRGDB00064286 (Zm.80312)

From PRG Wiki
Jump to: navigation, search
Zm.80312
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194693577 (BT035868)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0086I12 mRNA, complete cds

DNA Sequence

CGCATAATCATACTAGTGACACAATCACAGCTAGCCACCTCCCCGTCCCCAGCATCGCCAAAGGTCACATCGGTCGGCCACGGGCGCGGGGCAAGAAGGACCAGGTGACGGACGAGCAGGAGGGAGGAATAATGGCGGGCGCGGGCGCGGGCGGGTGGAAGAAGCGGGTGGGCCGCTACGAGGTGGGCCGGACCATCGGCCGGGGCACCTTCGCCAAGGTTAAGTTCGCCGTCGACGCCGACACCGGCGCGGCTTTCGCCATTAAGGTGCTCGACAAGGAGACCATCTTCACCCACCGCATGCTCCACCAGATCAAAAGGGAAATATCTATCATGAAGATCGTAAGACATCCCAACATAGTTAGGCTTAATGAGGTGTTGGCCGGCAGGACAAAGATATACATAGTCTTGGAACTTGTCACTGGAGGTGAACTGTTTGATAGAATAGTCCGCCATGGGAAGCTACGTGAGAATGAAGCTAGGAAGTATTTCCAGCAGCTTATTGATGCCATTGATTATTGCCACAGCAAAGGAGTTTATCATAGAGATTTGAAGCCTCAAAACTTGCTTCTTGACTCTCGTGGAAACTTGAAACTTTCTGATTTTGGACTTAGCACATTGTCTCAAAATGGAGTAGGCCTTGTACACACGACATGTGGAACACCAAATTATGTTGCACCTGAGGTGCTAAGTAGCAATGGATATGACGGATCTGCAGCAGACATTTGGTCGTGTGGTGTCATTCTCTATGTTTTAATGGCTGGTTACCTTCCCTTTGAGGAGAACGACCTTCCACATTTGTATGAAAAGATAACTGCAGCTCAGTACTCATGCCCATATTGGTTCTCTCCAGGAGCCAAGTCATTGATCCAGAGAATACTTGATCCAAATCCAAGAACTCGTATCACTATTGAAGAAATAAGAGAAGACCCATGGTTTAAGAAGAACTACGTAACTATTAGATGTGGTGAAGATGAAAATGTCAGCCTAGACGATGTTCAAGCTATTTTTGACAATATTGAGGACAAGTATGTATCAGACGAAGTAACGCACAAGGATGGTGGTCCTCTTATGATGAATGCCTTTGAGATGATTGCACTATCTCAAGGTTTGGATCTCTCAGCATTGTTTGATAGGCAACAGGAGTTTGTCAAGCGCCAAACACGTTTCGTCTCAAGAAAGCCAGCCAAGACTGTAGTAGCTACAATTGAGGTTGTTGCTGAGTCAATGGGTCTCAAGGTCCACTCCCGGAACTACAAGGTGAGGCTTGAAGGTCCAGCGTCAAACAGAGCGAGCCAATTTGCTGTTGTTCTAGAGGTCTTTGAAGTTGCTCCTTCTCTGTTCATGGTCGATGTTCGAAAGGTTGCCGGTGACACTCCGGAATACCACAGGTTTTACGAGAACCTATGCAGCAAACTTTGCAGCATAATCTGGAGGCCAACCGAAGTTTCTGCCAAATCTACGCCGCTGAGGACGACCACCTGCTAGCCGCCTAGCCCAGCACTGAGCTACTGTAGTGGCATCACCAAGAGACGTGATTCGTAGCCGTCAGAAAGGGAGAGCTTCTGTTGAATCTAGCATTGCTCGTGGAGCTGGGATTCATGTTGACCACCAGGTGTTTGTATATTGTAGTAACGCTATTGTAGATAGTCTGTATAGCTCCATTTGTGCAGTTGTACGTAGCAGGAATATGTTAAAAAACAACTTTTAATGTCAGGTATAATCGGTTTGCATCC


Protein sequences

Name Description Sequence
Zm.80312 translated coding region predicted by ESTScan from UniGene Zm.80312

XHNHTSDTITASHLPVPSIAKGHIGRPRARGKKDQVTDEQEGGIMAGAGAGGWKKRVGRYEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMMNAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNYKVRLEGPASNRASQFAVVLEVFEVAPSLFMVDVRKVAGDTPEYHRFYENLCSKLCSIIWRPTEVSAKSTPLRTPPASRLAQHXATVVASPRDVIRSRQKGRASVESSIARGAGIHVDHQVFVYCSNAIVDSLYSSICAVVRSRNMLKNNF

Domains

Domain Start-End Description Sequence

Seg: seg
42-52 seg

GGIMAGAGAGG

Gene3D: G3DSA:3.30.200.20
54-156 no description

KKRVGRYEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLR

superfamily: SSF56112
IPR011009
55-511 Protein kinase-like (PK-like)
Protein kinase-like domain

KRVGRYEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMMNAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNYKVRLEGPASNRASQFAVVLEVFEVAPSLFMVDVRKVAGDTPEYHRFYENLCSKLCSIIWRPTEVSAKSTPLRTPPASRLAQHXATVVASPRD

HMMPanther: PTHR24344
55-565 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE CDS1

KRVGRYEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMMNAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNYKVRLEGPASNRASQFAVVLEVFEVAPSLFMVDVRKVAGDTPEYHRFYENLCSKLCSIIWRPTEVSAKSTPLRTPPASRLAQHXATVVASPRDVIRSRQKGRASVESSIARGAGIHVDHQVFVYCSNAIVDSLYSSICAVVRSRNML

HMMPanther: PTHR24344:SF45
55-565 SUBFAMILY NOT NAMED

KRVGRYEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMMNAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNYKVRLEGPASNRASQFAVVLEVFEVAPSLFMVDVRKVAGDTPEYHRFYENLCSKLCSIIWRPTEVSAKSTPLRTPPASRLAQHXATVVASPRDVIRSRQKGRASVESSIARGAGIHVDHQVFVYCSNAIVDSLYSSICAVVRSRNML

HMMPfam: PF00069
IPR017442
60-313 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWF

ProfileScan: PS50011
IPR000719
60-313 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWF

HMMSmart: SM00219
IPR020635
60-311 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDP

HMMSmart: SM00220
IPR002290
60-313 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGRTIGRGTFAKVKFAVDADTGAAFAIKVLDKETIFTHRMLHQIKREISIMKIVRHPNIVRLNEVLAGRTKIYIVLELVTGGELFDRIVRHGKLRENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWF

PatternScan: PS00107
IPR017441
66-89 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGTFAKVKFAVDADTGAAFAIK

Gene3D: G3DSA:1.10.510.10
157-317 no description

ENEARKYFQQLIDAIDYCHSKGVYHRDLKPQNLLLDSRGNLKLSDFGLSTLSQNGVGLVHTTCGTPNYVAPEVLSSNGYDGSAADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPRTRITIEEIREDPWFKKNY

PatternScan: PS00108
IPR008271
179-191 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPQNLLL

ProfileScan: PS50816
IPR018451
354-378 NAF
NAF/FISL domain

GGPLMMNAFEMIALSQGLDLSALFD

HMMPfam: PF03822
IPR004041
356-415 NAF
NAF domain

PLMMNAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox