PRGDB00064287 (Zm.80361)

From PRG Wiki
Jump to: navigation, search
Zm.80361
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223973240 (BT064932)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0033N08 mRNA, complete cds

DNA Sequence

GCAGCGCTGCGGAAGCAGAGCGCGAGGAAGGAGACGGATTTGCTCGGCTGGGATCCCCCGCCAGGGGTCCACATGGCGGCGTCGCCTTGAGCCGGGCCTCTCCTACCCGCGACGTCCTGCGATGCCGCCGCGGGGAGCGGCGCTCCTCCTCCTCCTCGTCGTGCTCTGCGCAGTGCAACTGGGAACATCAAGCTCAACAAGTCTTGCATCATACTTATTCGGATTCTGGAGTAGAACCCACCAGCATCGCTTTCCTGCACTAGCCCCTGGCCCAGCCCCTTCTCCTCAACCTGAAGGCGCCATTATTGCTCACCCAGTGCATAGGCATCACAGAAGAAGACACCATGCTTCCCCACCACCTTCATCATTTTCGCCAGAAAGACAAGATTGCAGCAGAACAACTTGTTCTGCTCCACTTACGTCGACTCCAATTGGTTCACCCTGTGGTTGTGTATATCCTATGCAAATTCAGCTTGATCTTGGTGTGGCGCCGTATCAATTGTTTCCAAGAATTGATGAATTAGAAATCGAGGTGGCAGCAGGTACATTCTTGAAACAGAGTCAAGTTCGGATAATGGGTGCTGGGAGTAGTCTTCAAGATCCTGAAAAGACAACAGTGACCATTGATTTGGTGCCATTAGGCCAGAAATTTGATAGGACTTCAGCCTTACTGATTAGCAACAGATTTTTGCAAAAGAAGGTGCCAATAAACTCATCCACTTTTGGTGATTATGTTGCTACATATGTTCATTATCCAGGCCTTGCTTCTTTAGTACCTATTCCTGGATCATTGGGTCCAGTAAGCAGTAATGAGGACCCTTTTGGTGCAAATATACACAATAGAAGGCACCACAAGATTAACTCTAAAACTGTTGCCATAATTGCTCTATCAGCTGTGGTTTTTGTTTTGACGTGCTTGGCCATTGGCATCACTTGGAGATTCAATGGACTAAAACATTCTCATGCTATGGGCCCTATTTCAAGTTCGTCCATCATTAGAAAAGGAGCTATGAGGTCATCGTTCTCTGGTACGAGCAGCTCGGCAGCATCATTTGGTTCAACAATAGGAACCTGCCCATCCACCGTGAAGACATTTACAATAACTGAGCTTGAGAAGGCCACAGAAAACTTCAGCTTCAACAAAATAATAGGCGAAGGGGGTTATGGACGCGTCTATCGTGGTGTAATTGAAGATGGTGTTGAGGTTGCTGTCAAATTGCTCACAAGGAAACATCAAAACAGAGACCGCGAGTTCATTGCAGAGGTTGAGATGCTAAGTCGTCTACATCACCGCAACCTTGTCAAGCTGATTGGTATATGCATTGAGCGGAGCACAAGGTGCTTGGTTTTTGAGCTCGTTCCAAACGGAAGTGTTGAATCTCATCTACATGGCTCAGATAAAATATATGGCCCGACTGATTTTGACACTAGAATGAAAATAGCCCTCGGCGCAGCAAGGGGACTAGCCTATCTGCATGAGGACGCCAACCCTCATGTCATTCACCGGGATTTCAAGGCTAGCAATGTTCTACTGGAAAACGATTTCACCCCCAAGGTTGCTGATTTTGGGCTGGCAAAGGAAGCATCAGATGGGATGGATCATATTTCTACTCAGGTCATGGGGACTTTCGGGTACGTTGCCCCAGAGTATGCGATGACAGGGCATCTGCTTGTCAAGAGCGACGTCTACAGCTACGGAGTGGTGCTCCTGGAGCTGCTGTCAGGCCGAAAACCCGTGGACATGACCCAGCCGCCGGGGTCCGAGAACCTGGTCACCTGGGCGCGCCCGCTCCTCACCACGCGGGAAGGACTGCAGCGGCTGGTGGACCCGTCGCTCCCGGCCGGTTACGACTTCGAGAAGCTGGCCAAGGCGGCGGCCATCGCGTCCATGTGCGTGCACGTCGAGGCGTCGCACCGGCCGTTCATGGGCGAGGTCGTGCAGGCGCTGAAGCTGATCCACAGCGGCGGAGGCGGCGACGAGACCTGCAGCGGCTCCTTCGTGGGCGGCGCAACAGAGGAGTCCCCGTGGAACGACGTCAGCAGGAGCTCGTGGAACGACGACCCGCCGGCCACTCCGGGCCCGGCGCTCCCCCTGGGATACGGCTCGGACCCTGCCGGCGCCGACGAGCGCAGGCCACGGTCGGCGTCGAGCGCGGTGCTGGACAAGATCGAGTCCCTGGCGATGTACGACTGGTCCGGCCCGCTGCGCACCAAGGGGAGGGGCAGCTTCTACAGGCTGAGGGGGAGCATGAGCGAGCACGGTCGCCCCTCGGACGACGGTAGCGTCGAAGGTTACTTGATGTAGCCGGCGGCCCGACGACCGTGCGCAGCAGATTGCCGCGGCAGGCATACCTCGCGTTTCTTTTGTCTGTCTAGAATTGTATAGCTGCTGCTTGACGAGATTTTGGTGCCTGTTGCGAAGAATACATCGTTCTGGACATCGGACGTATCCGATGCAGTTTGGTCAAGAGATGTTCAGAATTTGCGTATGTCGAATTGAATCACATATCAGAGCTACATTGGTCGGATCGTCATGGACGAGAATCATGTTTTCATAGTAGAAAATGAGGAGGTTTATAATC


Protein sequences

Name Description Sequence
Zm.80361 translated coding region predicted by ESTScan from UniGene Zm.80361

AALRKQSARKETDLLGWDPPPGVHMAASPXAGPLLPATSCDAAAGSGAPPPPRRALRSATGNIKLNKSCIILIRILERTHQHRFPALAPGPAPSPQPEGAIIAHPVHRHHRRRHHASPPPSSFSPERQDCSRTTCSAPLTSTPIGSPCGCVYPMQIQLDLGVAPYQLFPRIDELEIEVAAGTFLKQSQVRIMGAGSSLQDPEKTTVTIDLVPLGQKFDRTSALLISNRFLQKKVPINSSTFGDYVATYVHYPGLASLVPIPGSLGPVSSNEDPFGANIHNRRHHKINSKTVAIIALSAVVFVLTCLAIGITWRFNGLKHSHAMGPISSSSIIRKGAMRSSFSGTSSSAASFGSTIGTCPSTVKTFTITELEKATENFSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQALKLIHSGGGGDETCSGSFVGGATEESPWNDVSRSSWNDDPPATPGPALPLGYGSDPAGADERRPRSASSAVLDKIESLAMYDWSGPLRTKGRGSFYRLRGSMSEHGRPSDDGSVEGYLMXPAARRPCAADCRGRHTSRFFCLSRIVXLLLDEILVPVAKNTSFWTSDVSDAVWSRDVQNLRMSNXITYQSYIGRIVMDENHVFIVENEEVYNX

Domains

Domain Start-End Description Sequence

Seg: seg
26-37 seg

AASPXAGPLLPA

Seg: seg
42-59 seg

AAAGSGAPPPPRRALRSA

HMMPanther: PTHR24420:SF801
95-720 SUBFAMILY NOT NAMED

PQPEGAIIAHPVHRHHRRRHHASPPPSSFSPERQDCSRTTCSAPLTSTPIGSPCGCVYPMQIQLDLGVAPYQLFPRIDELEIEVAAGTFLKQSQVRIMGAGSSLQDPEKTTVTIDLVPLGQKFDRTSALLISNRFLQKKVPINSSTFGDYVATYVHYPGLASLVPIPGSLGPVSSNEDPFGANIHNRRHHKINSKTVAIIALSAVVFVLTCLAIGITWRFNGLKHSHAMGPISSSSIIRKGAMRSSFSGTSSSAASFGSTIGTCPSTVKTFTITELEKATENFSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQALKLIHSGGGGDETCSGSFVGGATEESPWNDVSRSSWNDDPPATPGPALPLGYGSDPAGADERRPRSASSAVL

HMMPanther: PTHR24420
95-720 FAMILY NOT NAMED,FAMILY NOT NAMED

PQPEGAIIAHPVHRHHRRRHHASPPPSSFSPERQDCSRTTCSAPLTSTPIGSPCGCVYPMQIQLDLGVAPYQLFPRIDELEIEVAAGTFLKQSQVRIMGAGSSLQDPEKTTVTIDLVPLGQKFDRTSALLISNRFLQKKVPINSSTFGDYVATYVHYPGLASLVPIPGSLGPVSSNEDPFGANIHNRRHHKINSKTVAIIALSAVVFVLTCLAIGITWRFNGLKHSHAMGPISSSSIIRKGAMRSSFSGTSSSAASFGSTIGTCPSTVKTFTITELEKATENFSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQALKLIHSGGGGDETCSGSFVGGATEESPWNDVSRSSWNDDPPATPGPALPLGYGSDPAGADERRPRSASSAVL

Seg: seg
104-127 seg

HPVHRHHRRRHHASPPPSSFSPER

Seg: seg
339-354 seg

SSFSGTSSSAASFGST

superfamily: SSF56112
IPR011009
347-649 Protein kinase-like (PK-like)
Protein kinase-like domain

SAASFGSTIGTCPSTVKTFTITELEKATENFSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQAL

Gene3D: G3DSA:3.30.200.20
359-438 no description

PSTVKTFTITELEKATENFSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIG

ProfileScan: PS50011
IPR000719
377-652 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQALKLI

HMMSmart: SM00220
IPR002290
377-652 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQALKLI

HMMSmart: SM00219
IPR020635
377-649 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQAL

HMMPfam: PF07714
IPR001245
378-647 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SFNKIIGEGGYGRVYRGVIEDGVEVAVKLLTRKHQNRDREFIAEVEMLSRLHHRNLVKLIGICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQ

Seg: seg
383-397 seg

IGEGGYGRVYRGVIE

PatternScan: PS00107
IPR017441
383-405 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYGRVYRGVIEDGVEVAVK

Gene3D: G3DSA:1.10.510.10
439-647 no description

ICIERSTRCLVFELVPNGSVESHLHGSDKIYGPTDFDTRMKIALGAARGLAYLHEDANPHVIHRDFKASNVLLENDFTPKVADFGLAKEASDGMDHISTQVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTTREGLQRLVDPSLPAGYDFEKLAKAAAIASMCVHVEASHRPFMGEVVQ

PatternScan: PS00108
IPR008271
499-511 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDFKASNVLL

Seg: seg
686-699 seg

DDPPATPGPALPLG

Seg: seg
768-782 seg

XPAARRPCAADCRGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox