PRGDB00064288 (Zm.80407)

From PRG Wiki
Jump to: navigation, search
Zm.80407
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195648189 (EU971445)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 364839 atypical receptor-like kinase MARK mRNA, complete cds

DNA Sequence

GAAGAAACGGACGAGACCACTCTCAACCTCGGCTCGTTCCGGACCGGGCCCGCTCTCGCCACCTCAGCCGCCGCCGCGATGCGGTCGCCTTCGCCACCGCCGTGGCGGCTCCGGCGCATCCGTTTCTCGTTCCCCATGCTCCTCCTCGTCGCGTCGCTGGCGGGGGCCGACGACCTCGCGAGCGACGCGCGGGCGCTCGTGGCGTTCCGTGACGCCGTGGGGCGGCGCCTGGCGTGGAACGCCTCGGACGTCGCGGGCGCGTGCTCGTGGACGGGGGTCACCTGCGAGCACGGCCGCGTGGCGGTGCTGCGGCTTCCCGGGGCGACGCTCTCGGGGACAGTCCCCGCGGGGACGCTCGGGAACCTCACGGCGCTGCACACGCTCAGCCTCCGCCTCAACGGTCTCTCCGGCGCGCTCCCAGCCGACCTGTCTTCCGCCGCCGCGCTTCGTAACGTCTTCCTCAACGGGAACAGGCTGTCGGGCGGGTTCCCGCAGGCGATTCTCGCTCTCCCGGGGCTCGTCAGGCTCTCGCTCGGCGGGAACGACCTGTCCGGGCCCATTCCGGTGGAGCTCGACAACCTCACACACCTCAGGGTCCTGCTCCTTGAGAATAATCGCTTTTCCGGCGAGATTTCCGATGTGAAGCTACCGCCGTTGCAGCAGTTCAATGTCTCGTTCAACCAGCTGAACGGATCCATCCCGGCCTCACTTCGGTCGCAGCCGCGCTCCGCGTTTCTGGGGACGGGCTTGTGCGGCGGACCCTTGGGGCCTTGCCCTGGTGAGGTTCCCCCGTCCCCTGCTCCAGCGGGGCAGACACCGTCGCCGACGCCTGTTCCCAGTGGCAGGggcggcggcggcggcggcggcggcggcACCAACGGTGGAAGTGGCGTAGAAAATGGCCATAAGGGCAAGAAGCTCTCCGGTGGCGCCATTGCCGGAATCGTCATAGGCTCTGCCTTGGGCGCCGCACTTCTCCTCTTCCTCCTCGTCTGCCTCTGTCGCAGGTCGGGGGGCATCAGAACGCGGTCTCTGGAGATGCCACCTTCTTCCCCAGCGCCTGCCGGCGGCAGGAAACCTCCCGAGATGACTAGCGCTGCTGCTGTAGCGCCGTTGACCACGATAGGCCACCCCAACGCTCCTATTGTCCAGTCGACGTCCGGTAAGAAGCTGGTCTTCTTTGGGTCATCGGCCGCCGTGGCGTCTTTCAAGCTGGAGGACCTGCTGCGCGCGTCGGCTGAGGTGCTCGGAAAAGGAACGTTCGGGACGACGTACAAGGCAGTGCTCGAGTCTGGTGCAACTTTGGCCGTGAAGCGCCTCAAGGACGTGACTCTGTCTGAACCTGAGTTCCGTGAACGCATTTCTGAGATTGGCGAGCTTCAGCACGAGTTCATTGTGCCACTCCGTGCTTACTACTACAGCAAAGATGAAAAGCTACTTGTTTACGACTTCATGCCCAAGGGGAGCCTGTCTGCAGTCCTGCACGGCAACATAACTTCTGGCAAGACACCCCTTAACTGGGATTTAAGGTCAAGCATTGCTCTAGCTGCAGCCCGTGGTGTTGAGTACATCCACTCAACGAGCTCAACGGCTTCCCACGGTAACATCAAGTCATCCAATGTCCTCCTGGGCGAATCGTATCAAGCACACGTATCAGACAATGGCCTTACCGCTCTTGTTGGTCCATCGTCTTCACCGTCTCGCGCCACTGGATACCGTGCACCCGAGGTTATTGATCCCCGGAGGGTTTCCCAGAAGGCAGACGTGTACAGCTTCGGTGTTCTGTTGCTTGAGCTGGTCACAGGCAAGGCCCCCAGCCAGGCCGCTCTCAACGACGAGGGCGTCAACCTGCCCAGATGGGTGCAGTCAGTTAGTCGCTCCGAATGGGGTTCGGAGGTGTTCGATATTGAGCTCATGAGACACGAGGCTGACGAGGAGCTGATGGCTCAGCTTGTGCTGCTTGCTCTGGACTGCGTAGCGCAAGTCCCAGAGGCCCGGCCCTCAATGGGGCATGTTGTTACGCGGATAGAGGAGATCAGGAAGTCAAGCGTGACCACAAACATGGAGGAAGAAGTTGATGATCAATCTTCCAAGGCTGAATCGGAGGTGCCGACCAATCCGTTCACTTCTTGATCTCAGTTGACCTAAAAGAGAATCAGCTATAACTCTAGCCTGCATCCAATCGATCTTGGACTGAATCGACTCTTTTTCGTCTTTTAGCTTACATGATTTAACGGGTAACCTGATTGTCAAAAGTAGCACGGGTGCACGGCATCCGGTGCCGCGGAAGGTGACTGGTGGCGGTGTGCTTAGGGACCAGTTCTAAAGTGATTGCTAAATTGCTGTGCTCATTCTAGCCTTGATTAGtgctgctgctgctgctgctgTCATTCAGCTACCCATGTGTAATTACTGATAGCCCCATGTAGTGTTTGGAATTTCTTTTTGGCTGGATCAGTCTCTCGTTTGATCTGCTCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.80407 translated coding region predicted by ESTScan from UniGene Zm.80407

EETDETTLNLGSFRTGPALATSAAAAMRSPSPPPWRLRRIRFSFPMLLLVASLAGADDLASDARALVAFRDAVGRRLAWNASDVAGACSWTGVTCEHGRVAVLRLPGATLSGTVPAGTLGNLTALHTLSLRLNGLSGALPADLSSAAALRNVFLNGNRLSGGFPQAILALPGLVRLSLGGNDLSGPIPVELDNLTHLRVLLLENNRFSGEISDVKLPPLQQFNVSFNQLNGSIPASLRSQPRSAFLGTGLCGGPLGPCPGEVPPSPAPAGQTPSPTPVPSGRGGGGGGGGGTNGGSGVENGHKGKKLSGGAIAGIVIGSALGAALLLFLLVCLCRRSGGIRTRSLEMPPSSPAPAGGRKPPEMTSAAAVAPLTTIGHPNAPIVQSTSGKKLVFFGSSAAVASFKLEDLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSVTTNMEEEVDDQSSKAESEVPTNPSLLDLSXPKRESAITLACIQSILDXIDSFSSFSLHDLTGNLIVKSSTGARHPVPRKVTGGGVLRDQF

Domains

Domain Start-End Description Sequence

Seg: seg
17-41 seg

PALATSAAAAMRSPSPPPWRLRRIR

HMMPanther: PTHR24420
27-741 FAMILY NOT NAMED,FAMILY NOT NAMED

MRSPSPPPWRLRRIRFSFPMLLLVASLAGADDLASDARALVAFRDAVGRRLAWNASDVAGACSWTGVTCEHGRVAVLRLPGATLSGTVPAGTLGNLTALHTLSLRLNGLSGALPADLSSAAALRNVFLNGNRLSGGFPQAILALPGLVRLSLGGNDLSGPIPVELDNLTHLRVLLLENNRFSGEISDVKLPPLQQFNVSFNQLNGSIPASLRSQPRSAFLGTGLCGGPLGPCPGEVPPSPAPAGQTPSPTPVPSGRGGGGGGGGGTNGGSGVENGHKGKKLSGGAIAGIVIGSALGAALLLFLLVCLCRRSGGIRTRSLEMPPSSPAPAGGRKPPEMTSAAAVAPLTTIGHPNAPIVQSTSGKKLVFFGSSAAVASFKLEDLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSVTTNMEEEVDDQSSKAESEVPTNPSLLDLSXPKRESAITLACIQSILDXIDSFSSFSL

HMMPanther: PTHR24420:SF537
27-741 SUBFAMILY NOT NAMED

MRSPSPPPWRLRRIRFSFPMLLLVASLAGADDLASDARALVAFRDAVGRRLAWNASDVAGACSWTGVTCEHGRVAVLRLPGATLSGTVPAGTLGNLTALHTLSLRLNGLSGALPADLSSAAALRNVFLNGNRLSGGFPQAILALPGLVRLSLGGNDLSGPIPVELDNLTHLRVLLLENNRFSGEISDVKLPPLQQFNVSFNQLNGSIPASLRSQPRSAFLGTGLCGGPLGPCPGEVPPSPAPAGQTPSPTPVPSGRGGGGGGGGGTNGGSGVENGHKGKKLSGGAIAGIVIGSALGAALLLFLLVCLCRRSGGIRTRSLEMPPSSPAPAGGRKPPEMTSAAAVAPLTTIGHPNAPIVQSTSGKKLVFFGSSAAVASFKLEDLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSVTTNMEEEVDDQSSKAESEVPTNPSLLDLSXPKRESAITLACIQSILDXIDSFSSFSL

Seg: seg
47-68 seg

LLLVASLAGADDLASDARALVA

superfamily: SSF52058
52-239 L domain-like,LRR

SLAGADDLASDARALVAFRDAVGRRLAWNASDVAGACSWTGVTCEHGRVAVLRLPGATLSGTVPAGTLGNLTALHTLSLRLNGLSGALPADLSSAAALRNVFLNGNRLSGGFPQAILALPGLVRLSLGGNDLSGPIPVELDNLTHLRVLLLENNRFSGEISDVKLPPLQQFNVSFNQLNGSIPASLRS

HMMPfam: PF08263
IPR013210
60-95 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ASDARALVAFRDAVGRRLAWNASDVAGACSWTGVTC

Gene3D: G3DSA:3.80.10.10
70-239 no description

RDAVGRRLAWNASDVAGACSWTGVTCEHGRVAVLRLPGATLSGTVPAGTLGNLTALHTLSLRLNGLSGALPADLSSAAALRNVFLNGNRLSGGFPQAILALPGLVRLSLGGNDLSGPIPVELDNLTHLRVLLLENNRFSGEISDVKLPPLQQFNVSFNQLNGSIPASLRS

Seg: seg
135-149 seg

LSGALPADLSSAAAL

Seg: seg
247-270 seg

GTGLCGGPLGPCPGEVPPSPAPAG

Seg: seg
281-297 seg

GRGGGGGGGGGTNGGSG

Seg: seg
307-334 seg

LSGGAIAGIVIGSALGAALLLFLLVCLC

superfamily: SSF56112
IPR011009
385-676 Protein kinase-like (PK-like)
Protein kinase-like domain

STSGKKLVFFGSSAAVASFKLEDLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRI

ProfileScan: PS50011
IPR000719
410-679 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEI

HMMSmart: SM00220
IPR002290
410-685 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSVT

HMMSmart: SM00219
IPR020635
410-676 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRI

HMMPfam: PF00069
IPR017442
414-673 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVV

Gene3D: G3DSA:3.30.200.20
416-472 no description

LGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPEFRERISEIGELQHEFIVPLRAYY

PatternScan: PS00107
IPR017441
416-438 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGTFGTTYKAVLESGATLAVK

Gene3D: G3DSA:1.10.510.10
473-695 no description

YSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEWGSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSVTTNMEEEVDDQ

Seg: seg
728-741 seg

SILDXIDSFSSFSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox