PRGDB00064289 (Zm.80486)

From PRG Wiki
Jump to: navigation, search
Zm.80486
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223946362 (BT062568)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0315C08 mRNA, complete cds

DNA Sequence

CTGAAGTTGGTGGAATCTGTTTACAGGGAGAAGCAGAAACAGAACGGGAATTGTTATAGCAATTGTATTGCCTATAGTTGCTGGCGTGCTAGCTATAACTATGGTTTGTCTCTGTTTCCTGTGGAGGAGAAGGCCAGCAAGAGATCAGACATCATCTTATTCAGTTAATCAATCAGAGATTGAAAGTATTGATTCACTTCTTCTCGATATATCAATGCTACGTGCTGCAACTGATAACTTTGCTGAGAGCAATAGGCTTGGTGAAGGAGGTTTTGGTACAGTCTATAAGGGTGTCCTTCCTGACAACCAAGAAATTGCAGTGAAGAGGCTCTCACAGAGCTCAGGGCAAGGAATACAAGAGCTGAAAAATGAGCTTGTTTTGGTTGCCAAGCTTCAGCACAAGAATCTTGTCAGGCTTGTTGGTGTTTGCTTGCAAGAATATGAGAAACTGCTTGTGTATGAATACATGCCCAACAAAAGCATCGACACCATTCTTTTTGATTCTGAGAAAAGCAAGGAGCTAGATTGGGGAAAGAGAGTTAAGATAATAGATGGAATTGCTCGAGGGTTACAGTATCTCCATGAAGATTCTCAGTTGAAGATTATTCACCGGGACCTTAAGGCGAGCAATGTCCTTTTAAACTCTGATTATACTCCTAAGATATCTGATTTTGGCCTAGCAAGGCTATTTGGTGGGGATCAATCACGGGAGGTCACAAATCGAGTCGTCGGAACATATGGATATATGTCTCCAGAGTATGCCATGCGTGGCCACTATTCTATAAAGTCAGATGTCTTCAGCTTCGGCGTCTTGATCCTGGAAATATTAACCGGAAGAAGCAGCAGTGGTTCCTTTAATATCGAGCAATCTGTTGATCTCTTAAGTCTTGTCTGGGAGCACTGGACAATGGGAACAATTGTGGAGATCATGGATCCATCTCTGAGAGGCAAAGCTCCTGCAGAACAGATGCTGAAAAATGTCCATATCGGGCTACTGTGTGTTCAAGATAACCCTGTTGATAGACCGAAGATGTCAACAGTAAACATCATGCTCAGCAGTGGCACTATGCCTCTCCAGTCTCCATTAAAGCCAGCATTCTTCATTCCCAAGAGCGGCTACTACTCAACTGTTCATTCAGAATCATATCCTATAGCTTCCCGATCCGTCGATAATGGCAAGCCAGGGGCGATATCACCAAACGAAGTGTCAATTACAGAGCTGGAACCAAGATGAGGCCATAGTAGTTGGACATGGTTGTTTGTTGTAGCATCTAACACTTGACGCTAGTGGCTAAGGACTTTTTTACCCAGGCACATGGGTGACAGTTTAGCCTTAGAATTGATTGTCATTAGTGCTTGAGATCTTTTTTCCCTTTTGTTCGAACCAGAAATGAGCCGGCGGACTGTCCGGCCCTGAGGCCGGACGGTCCGCGGTCCGGACGGTCCGCGCCTGTGGGCCGGACGGTCCGCGCGTGCGCAGAACAGATTAGGGTTCCGAGTTTTGTGCTACGGTTGTTAGCTATATTCGCGGGATTAGCTCGGAATCAGTTGTGTAAAGGGTCCAGCCCCCCTCCTCTATAAATAGAGAGGTCTACGACCGATTTGTAATCATCAACAATCGAATCAATACAACTTCTATTCGCATTTT


Protein sequences

Name Description Sequence
Zm.80486 translated coding region predicted by ESTScan from UniGene Zm.80486

LKLVESVYREKQKQNGNCYSNCIAYSCWRASYNYGLSLFPVEEKPARDQTSSYSVNQSEIESIDSLLLDISMLRAATDNFAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKMSTVNIMLSSGTMPLQSPLKPAFFIPKSGYYSTVHSESYPIASRSVDNGKPGAISPNEVSITELEPR

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
50-351 Protein kinase-like (PK-like)
Protein kinase-like domain

TSSYSVNQSEIESIDSLLLDISMLRAATDNFAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKMSTVNIML

HMMPanther: PTHR24420:SF430
51-408 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SSYSVNQSEIESIDSLLLDISMLRAATDNFAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKMSTVNIMLSSGTMPLQSPLKPAFFIPKSGYYSTVHSESYPIASRSVDNGKPGAISPNEVSITELE

HMMPanther: PTHR24420
51-408 FAMILY NOT NAMED,FAMILY NOT NAMED

SSYSVNQSEIESIDSLLLDISMLRAATDNFAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKMSTVNIMLSSGTMPLQSPLKPAFFIPKSGYYSTVHSESYPIASRSVDNGKPGAISPNEVSITELE

Seg: seg
58-71 seg

SEIESIDSLLLDIS

Gene3D: G3DSA:3.30.200.20
71-142 no description

SMLRAATDNFAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGV

ProfileScan: PS50011
IPR000719
80-351 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKMSTVNIML

HMMSmart: SM00220
IPR002290
80-339 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPV

HMMSmart: SM00219
IPR020635
80-351 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAESNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKMSTVNIML

HMMPfam: PF00069
IPR017442
83-281 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNRLGEGGFGTVYKGVLPDNQEIAVKRLSQSSGQGIQELKNELVLVAKLQHKNLVRLVGVCLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSS

PatternScan: PS00107
IPR017441
86-108 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGTVYKGVLPDNQEIAVK

Gene3D: G3DSA:1.10.510.10
143-344 no description

CLQEYEKLLVYEYMPNKSIDTILFDSEKSKELDWGKRVKIIDGIARGLQYLHEDSQLKIIHRDLKASNVLLNSDYTPKISDFGLARLFGGDQSREVTNRVVGTYGYMSPEYAMRGHYSIKSDVFSFGVLILEILTGRSSSGSFNIEQSVDLLSLVWEHWTMGTIVEIMDPSLRGKAPAEQMLKNVHIGLLCVQDNPVDRPKM

PatternScan: PS00108
IPR008271
201-213 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox