PRGDB00064292 (Zm.80780)

From PRG Wiki
Jump to: navigation, search
Zm.80780
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223975356 (BT065990)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0135I05 mRNA, complete cds

DNA Sequence

CGCCTTTGTTGATCTTTTCCTCTCTCGCGTTCccctcgccttcctcttcctcccccacacccaccggtcgccgcccccgtcgccccgtcctcctcGGTCCAGAGACGAGGGGGTCCGCGCCGTTCCGACGCCACACCGCAACCGCATCACATCACACACCGCCTGCTCCCACCGTCCGTCCGCCCTCCCTCGATCGCGCCCCCCGGATCGCTGGTACCTCCGCGCGCGGCTCCGACCTCATCTTCCTCCATCGACTGGCATCGGCAGCGGCGGCGTGTTCCCGGCCAGCCTTCGAAAGGATGGCACCAATTCACCCCAAATCACCAGTCACTGACCAGTGGGACCAGGTAATCAATCGCCAGACTTTTGGGAGCTCTGTTgggggggaccggggggAAGAGCCAAGTTACTGCAGAGGCTAACATTTCGGTTGTCGAGTGATGGCGCAAGGCATCAACTTCCCTGACTTCATCGGCGCCGTGGGTGGCCATGATGGTGGTGTGGACTTTGGTGGGAACTTCTGTGACATGGCCTTCTACCAGAAGCTAGGGGAGGGCACCAACATGTCGGTCGACAGCCTCAACAGCATGCAGACCAGCATGCATGGGGGGTCCATCGCCATGTCTGTGGACAACAACAGCAGCGTTGGCTCTAACAGTGACTCCCGCACTGGCATGCTTGGTCATCCTGGTCTCAAGGGGCCTGCCATTGTGGGAAGCTACTCGGTTGGGCACAGCATCTTCCGCCCTGGCCGGGTGTCCCACGCCTTGAGTGAGGATGCGCTGGCACATGCTCTGATGGACAATAAGTTCCCAACTGAGACACTCAAGGATTATGAGGAGTGGACTATTGATCTGGGGAAGCTCCACTTGGGAATGCCCTTTGCACAAGGTGCCTTTGGGAAGCTCTACAGGGGAACATACAATGGGATGGATGTTGCTATTAAGCTTTTGGAGCGACCTGAGGCTGACCCTGAGAAAGCTCAACTGTTAGAGCAGCAGTTTGTCCAAGAAGTTATGATGCTTGCAACACTGAGGCACCCGAATATTGTCAAGTTCATTGGTGCGTGCAGGAAGCCGTTGGTTTGGTGTATTGTGACGGAGTATGCAAAGGGTGGATCTCTCAAGAATTTCTTGAGCAAGAGGCAGAACAGGTCTGTCCCGCTGAAGTTGGCAGTCAAGCAGGCATTGGATGTTGCACGTGGCATGGCCTATGTCCATGGCCTTGGGTTCATTCATAGAGATCTTAAGTCGGACAACCTCCTGATTTCTGGTGATAAGTCCATTAAGATTGCTGACTTTGGAGTGGCTAGGATTGAAGTCAAGACTGAGGGGATGACACCTGAAACTGGAACATACCGCTGGATGGCTCCTGAAATGATCCAGCATAGGCCATACAACCAGAAAGTTGATGTCTACAGTTTTGCCATTGTCCTGTGGGAGTTAGTGACTGGGAATGTCCCCTTTGCAAACATGAGCGCAGTGCAAGCTGCATTTGCTGTGGTTAACAAGGGCGTGCGACCAGCCATACCCCACGACTGCCTCCCTGCCCTTGCGGAGATCATGACCATGTGCTGGGACACAAACCCTGAAGTCCGTCCCCCATTCGCTGAGATTGTGAGGATGCTGGAGCAGGTGGAGGTGGAGGTTCTGACCACTGTCCGTAAGGCTCGCTTCCGCTGTTGCATCGCCCAACCGATGACGCTGGACTGACGGACTGAGTCGTCCGCAATCCAGGAAAAGAACCTGGAGAGGGGTTTAATCCTATGTGTTTATAATCCCAATAGACTTGTGCTTCAGAAACAGAAGGCTGACTCCTCAGTCTGCTCCTCAGTCTGCCTTCTGTCTTTGACATGTTATCGTAGAGTACACCTAGCTGTCGTCACCAGTGGTTGTAATAGAGGTAGCTTTATGCTTGACTAAATACCCTTCCGTTATAACAAGTGCATGCTCTTGCTGCT


Protein sequences

Name Description Sequence
Zm.80780 translated coding region predicted by ESTScan from UniGene Zm.80780

XPLLIFSSLAFPSPSSSSPTPTGRRPRRPVLLGPETRGSAPFRRHTATASHHTPPAPTVRPPSLDRAPRIAGTSARGSDLIFLHRLASAAAACSRPAFERMAPIHPKSPVTDQWDQVINRQTFGSSVGGDRGEEPSYCRGXHFGCRVMAQGINFPDFIGAVGGHDGGVDFGGNFCDMAFYQKLGEGTNMSVDSLNSMQTSMHGGSIAMSVDNNSSVGSNSDSRTGMLGHPGLKGPAIVGSYSVGHSIFRPGRVSHALSEDALAHALMDNKFPTETLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQVEVEVLTTVRKARFRCCIAQPMTLDXRTESSAIQEKNLERGLILCVYNPNRLVLQKQKADSSVCSSVCLLSLTCYRRVHLAVVTSGCNRGSFMLD

Domains

Domain Start-End Description Sequence

Seg: seg
2-34 seg

PLLIFSSLAFPSPSSSSPTPTGRRPRRPVLLGP

Seg: seg
87-92 seg

ASAAAA

Seg: seg
159-172 seg

GAVGGHDGGVDFGG

Seg: seg
209-222 seg

SVDNNSSVGSNSDS

HMMPanther: PTHR23257
261-589 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

ALAHALMDNKFPTETLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQVEVEVLTTVRKARFRCCIAQPMTLDXRTESSAIQEKNLERGLIL

HMMPanther: PTHR23257:SF82
261-589 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

ALAHALMDNKFPTETLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQVEVEVLTTVRKARFRCCIAQPMTLDXRTESSAIQEKNLERGLIL

Gene3D: G3DSA:3.30.200.20
271-355 no description

FPTETLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIG

superfamily: SSF56112
IPR011009
275-574 Protein kinase-like (PK-like)
Protein kinase-like domain

TLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQVEVEVLTTVRKARFRCCIAQPMTLDXRTE

ProfileScan: PS50011
IPR000719
289-551 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQVEVEVL

HMMSmart: SM00220
IPR002290
289-546 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQV

HMMSmart: SM00219
IPR020635
289-543 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRML

HMMPfam: PF07714
IPR001245
290-543 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

HLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEKAQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRML

Gene3D: G3DSA:1.10.510.10
356-543 no description

ACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVRPAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRML

FPrintScan: PR00109
IPR001245
367-380 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYAKGGSLKNFLS

FPrintScan: PR00109
IPR001245
405-423 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YVHGLGFIHRDLKSDNLLI

PatternScan: PS00108
IPR008271
411-423 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKSDNLLI

FPrintScan: PR00109
IPR001245
451-461 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEMI

FPrintScan: PR00109
IPR001245
470-492 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVYSFAIVLWELVTGNVPFANM

FPrintScan: PR00109
IPR001245
514-536 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CLPALAEIMTMCWDTNPEVRPPF

Seg: seg
543-554 seg

LEQVEVEVLTTV

Seg: seg
606-617 seg

SSVCSSVCLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox