PRGDB00064293 (Zm.81057)

From PRG Wiki
Jump to: navigation, search
Zm.81057
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21209271 (AY106193)
Gene Class Unknown
Domain Type LRR
Gene Species Zea mays

Comment?

Zea mays PCO120598 mRNA sequence

DNA Sequence

TTCGGCACGAGGCACTACCCCATCCCCGGTGCGGCGCCACCTTCCCGGCTTCCCCTTCCGACCTCCCCCCTCTCGTCACTTATGGTGCCCAGCCGCTCGCTGCGCAACTACTAGCGCACCGTCCCCTCCTCAGCCATGGCCGCGGCGTCGTTCGCCCGCGCCTTATGTCTCCACATGCTCCTCCTCTTCCTCGTGGTTGGCTCGGCGCGCTGCAAGACGGTGAAGAGAGACGTGAAAGCATTGAATGAGATCAAATCTTCACTAGGCTGGAGAGTTGTATACTCATGGGTCGGTGATGATCCTTGTGGGCATGGTGATCTACCCCCCTGGTCTGGTGTGACATGTTCTCAGCAAGGGGATTACAGAGTTGTGACGGAACTGGAAGTCTATGCTGTATCAATAGTTGGCCCTTTCCCAACAGCAGTAACTAACCTGTTGGATCTAAGAAGATTGGATCTCCACAATAACAAGTTGACAGGACCAATTCCCCCACAGATTGGACGGTTGAAACATCTCAGGATATTGAACCTGAGGTGGAATAAGCTTCAAGATGTGCTTCCACCTGAAATTGGTGAACTGAAGAAACTGACACACTTGTATTTGAGCTTCAACAACTTCAAAGGCGAGATTCCAGTGGAGCTTGCAAACCTGCCAGAACTCCGTTACCTTTATCTTCACGAGAACCGCTTCACCGGGCGAATCCCCCCTGAACTTGGAACGCTAAAGAACCTACGTCACCTCGACGTGGGCAACAACCACCTGACAGGCACTCTCAGGGATTTTATCGGCAACGGGAACGGCTTCCCGTCCCTGAGAAATCTATACCTTAACAACAATGAGCTGACTGGTGTGCTGCCAGACCAGATTGCAAACCTGACAAACCTTGAGATTCTGCACTTGTCCAATAACAAGATGATCGGGTCGATATCGCCTAAGCTAGTTCACATTCCAAGGCTGATCTACTTGTACTTGGACAATAACAACTTCATTGGGAGGATACCGGAAGGGTTGTACAGGCATCCATTTCTGAAGGAGCTGTACATCGAAGGAAACCACTTCAGACCAGGAACCAGATCGAAGGGAACGCACAAGGTGCTGGAACTGCCTGACGCCGACATTCTAGTCTAGCAAGCTCGTTTAGGGGACCTGAGGTCTTGGCGTCCTGCAGTAGTAGACTGCTGCCGGTACCAGGATCACTTCTGTCTGTCGCTGTACTATTCCGTGGCAAAACTACAGTTGAGaaaaaaaaagtctcttgcaaaaaaaaagaggcaaaaaaaaaaaGTGAATAGTAGAGGCCACGGTCACACTGCCGTCATCGTTGGATGAGCCATGAGTGTACAGGTTGTATTGTTCTGCCCTGCATCTTCGCTGTATGATGGAGATGCCGGTCAGATGTAAAGCCAGCACATCGCATGGCACCGACAGTCCTGGTACAACTAGTGGCCAATGATATATGGCCTCTTTCGGAAGCAAATTTGGTGCCACCaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.81057 translated coding region predicted by ESTScan from UniGene Zm.81057

MAAASFARALCLHMLLLFLVVGSARCKTVKRDVKALNEIKSSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHLTGTLRDFIGNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLEILHLSNNKMIGSISPKLVHIPRLIYLYLDNNNFIGRIPEGLYRHPFLKELYIEGNHFRPGTRSKGTHKVLELPDADILV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF518
10-309 PTHR24420:SF518

LCLHMLLLFLVVGSARCKTVKRDVKALNEIKSSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHLTGTLRDFIGNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLEILHLSNNKMIGSISPKLVHIPRLIYLYLDNNNFIGRIPEGLYRHPFLKELYIEGNHFR

HMMPanther: PTHR24420
10-309 PTHR24420,FAMILY NOT NAMED

LCLHMLLLFLVVGSARCKTVKRDVKALNEIKSSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHLTGTLRDFIGNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLEILHLSNNKMIGSISPKLVHIPRLIYLYLDNNNFIGRIPEGLYRHPFLKELYIEGNHFR

superfamily: SSF52058
26-309 SSF52058,LRR

CKTVKRDVKALNEIKSSLGWRVVYSWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHLTGTLRDFIGNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLEILHLSNNKMIGSISPKLVHIPRLIYLYLDNNNFIGRIPEGLYRHPFLKELYIEGNHFR

HMMPfam: PF08263
IPR013210
30-71 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

KRDVKALNEIKSSLGWRVVYSWVGDDPCGHGDLPPWSGVTCS

Gene3D: G3DSA:3.80.10.10
50-308 G3DSA:3.80.10.10

SWVGDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHLTGTLRDFIGNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLEILHLSNNKMIGSISPKLVHIPRLIYLYLDNNNFIGRIPEGLYRHPFLKELYIEGNHF

HMMPfam: PF00560
IPR001611
103-123 LRR_1
Leucine-rich repeat

LRRLDLHNNKLTGPIPPQIGR

FPrintScan: PR00019
103-116 LEURICHRPT,Leucine-rich repeat signature

LRRLDLHNNKLTGP

HMMPfam: PF12799
127-162 LRR_4,Leucine Rich repeats (2 copies)

LRILNLRWNKLQDVLPPEIGELKKLTHLYLSFNNFK

HMMPfam: PF12799
173-210 LRR_4,Leucine Rich repeats (2 copies)

PELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHLT

HMMPfam: PF13855
224-284 LRR_8,Leucine rich repeat

PSLRNLYLNNNELTGVLPDQIANLTNLEILHLSNNKMIGSISPKLVHIPRLIYLYLDNNNF

FPrintScan: PR00019
247-260 LEURICHRPT,Leucine-rich repeat signature

LTNLEILHLSNNKM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox