PRGDB00064294 (Zm.81194)

From PRG Wiki
Jump to: navigation, search
Zm.81194
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 120481344 (EH211263)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Peri-Hc11.R Zea mays LCM amplified pericyle cell specific pGEM library Zea mays cDNA, mRNA sequence

DNA Sequence

TGTTGAAAAGAGGAGGCCAGGTGATCTACTCTGGGAAATTGGGTCGCAACTCCCAGAAAATGGTGGAGTATTTTGAGGCAATTCCTGGAGTGCCTAAAATAAAAGATAAGTACAATCCTGCAACGTGGATGCTCGAGGTCAGTTCAGTTGCAACTGAAGTGCGACTAAAGATGGATTTTGCTAAGTACTATGAAACATCAGATCTGTATAAGCAAAACAAGGTACTGGTGAACCAGCTGAGTCAACCAGAGCCAGGAACATCAGATCTTTATTTCCCTACAGAGTACTCGCAATCCACAATAGGACAGTTCAAAGCCTGTCTCTGGAAGCAATGGCTGACTTATTGGCGCAGCCCGGATTACAACCTTGTTAGATATTCCTTCACTCTGTTAGTTGCCTTGCTTCTCGGCTCCATTTTCTGGAGGATAGGCACCAACATGGAAGATGCAACCACTCTCGGTATGGTTATTGGAGCAATGTACACTGCTGTTATGTTTATCGGCATCAACAATTGTTCAACTGTGCAGCCAGTTGTTTCAATTGAAAGAACGGTCTTCTACAGAGAGAGGGCTGCTGGGATGTACTCTGCTATGCCATATGCCATTGCTCAGGTTGTTATAGAGATACCATATGTATTTGTGCAAACAACGTACTACACCCTCATTGTATACGCCATGATGAGCTTCCAATGGACAGCTGTCAAGttcttctggttcttcttcatttcctacttctccttcctctacttcACCTACTATGGCATGATGGCTGTCTCAATCTCCCCAAACCACGAGGTTGCATCCATCTTCGCAGCAGCTTTCTTTTCTCTCTT


Protein sequences

Name Description Sequence
Zm.81194 translated coding region predicted by ESTScan from UniGene Zm.81194

XLKRGGQVIYSGKLGRNSQKMVEYFEAIPGVPKIKDKYNPATWMLEVSSVATEVRLKMDFAKYYETSDLYKQNKVLVNQLSQPEPGTSDLYFPTEYSQSTIGQFKACLWKQWLTYWRSPDYNLVRYSFTLLVALLLGSIFWRIGTNMEDATTLGMVIGAMYTAVMFIGINNCSTVQPVVSIERTVFYRERAAGMYSAMPYAIAQVVIEIPYVFVQTTYYTLIVYAMMSFQWTAVKFFWFFFISYFSFLYFTYYGMMAVSISPNHEVASIFAAAFFSLX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
4-277 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

RGGQVIYSGKLGRNSQKMVEYFEAIPGVPKIKDKYNPATWMLEVSSVATEVRLKMDFAKYYETSDLYKQNKVLVNQLSQPEPGTSDLYFPTEYSQSTIGQFKACLWKQWLTYWRSPDYNLVRYSFTLLVALLLGSIFWRIGTNMEDATTLGMVIGAMYTAVMFIGINNCSTVQPVVSIERTVFYRERAAGMYSAMPYAIAQVVIEIPYVFVQTTYYTLIVYAMMSFQWTAVKFFWFFFISYFSFLYFTYYGMMAVSISPNHEVASIFAAAFFSL

HMMPanther: PTHR19241:SF10
4-277 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

RGGQVIYSGKLGRNSQKMVEYFEAIPGVPKIKDKYNPATWMLEVSSVATEVRLKMDFAKYYETSDLYKQNKVLVNQLSQPEPGTSDLYFPTEYSQSTIGQFKACLWKQWLTYWRSPDYNLVRYSFTLLVALLLGSIFWRIGTNMEDATTLGMVIGAMYTAVMFIGINNCSTVQPVVSIERTVFYRERAAGMYSAMPYAIAQVVIEIPYVFVQTTYYTLIVYAMMSFQWTAVKFFWFFFISYFSFLYFTYYGMMAVSISPNHEVASIFAAAFFSL

HMMPfam: PF01061
IPR013525
103-277 ABC2_membrane
ABC-2 type transporter

QFKACLWKQWLTYWRSPDYNLVRYSFTLLVALLLGSIFWRIGTNMEDATTLGMVIGAMYTAVMFIGINNCSTVQPVVSIERTVFYRERAAGMYSAMPYAIAQVVIEIPYVFVQTTYYTLIVYAMMSFQWTAVKFFWFFFISYFSFLYFTYYGMMAVSISPNHEVASIFAAAFFSL

Seg: seg
236-253 seg

FFWFFFISYFSFLYFTYY

Seg: seg
270-275 seg

FAAAFF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox