PRGDB00064298 (Zm.82520)

From PRG Wiki
Jump to: navigation, search
Zm.82520
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194694363 (BT036261)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0104A03 mRNA, complete cds

DNA Sequence

CGGCAGTTAAAAAGGGTGGGACGCCACCTTTCCCGCGGAAAGAGGAGCTCCCACCGCTAATCCATCGTCCTCGTCCCTCCCTACCCGCGGCCGGCCACCCACGCCGTTGCTGCTGTTCTGGCGCGCCCTCCACCTCTTCGTCTCTCGTAGGTGCCGTCGTCGGAGCTTGCTTTTGGGGAGGTCGTGCGGCATGATCTGCTGACCGCCCCAAATCAACCCGGCCGCGCATCGACCGTCGTCATCCAGTCCGACgaggaggaggaggaggagagggagaggggggagCCACAAAACTAAGATGTCTTGCTGCGGTGGCGCCGAGGAGGACAGCTACGGCCCGCCGGCCAACCAGGCGGTTCCACCACCCAATGCCAACGCCCCCGGCAACAGAGGCGGGCCGAGAGGACCGGGGGCGCCGAGGGTCGGCGGCCCCGCCAAGCCCGTCAGCATTGACGTGCCCGCCATACCCTTCGACGAGCTCAAAAGGATCACCAACAACTTCAGCGACCGCGCCCTCATCGGCGAGGGCTCCTACGGCCGCGTCTACAACGCCACGCTCAGCGACGGCCGCGCCGCCGTCATCAAGAAGCTCGACACCAGCGCCTCGCAGGACTCCGACACCGACTTCGCCGCGCAGATCGCGATGGTCTCCAAGCTGAAGAACGAGTATTTCCTGGAGCTCCTAGGGTACTGCTTGGAAGACGGCAACCGAATGCTAACCTATCAGTTCGCCACAATGGGTTCTTTGCACAACATACTACACGGGAAGAAGGGAGTCCAGGGCGCGGAGCCCGGTCCCGTCCTCAACTGGGCTCAGCGAGTCAAGATAGCCTACGGGGCAGCGAGAGGGCTGGAGTACCTGCACGAGAAGGTCCAGCCGTCCATCGTCCACCGGGACATCCGCTCCAGCAACGTCCTCATCTTCGACGACTTCAGCTCCAAGATCGCCGATTTCAACCTCACCAGCCAGGGCACCGACACCGCCGCGCGGTTGCACTCCACTCGCGTGCTAGGGACTTTCGGATACCACGCCCCAGAATACGCTATGACAGGCCAGATCAACCAAAAGAGCGACGTCTACAGCTTCGGCGTGATTCTTCTAGAGTTGCTGACCGGAAGGAAGCCGGTCGACCACACAATGCCGAAAGGCCAGCAGAGTCTTGTTACTTGGGCCACTCCGAGGTTGAGTGAAGACAAAGTGAAGCAGTGTGTTGATCCAAAGCTCGACAGTGACTACCCTCCGAAGGCCGTTGCGAAGCTGGCAGCAGTTGCGGCGTTGTGCGTTCAGTACGAATCCGACTTCCGGCCAAACATGACTATCGTGGTGAAGGCGATCACGCCTCTTCTGAACGCGCCCAAACCGGCAGCTCCAGCCGCGCCACAGTCCTGATCAACCCAGACGACAGAATTAGCCTGGACCTGGACACGGTTCCCCTGATCTGTTCCTCATTGCAGATGTATGCTAAGGAACCACGCATCCTTGCTCCATCCATCCATTGCATACAGGGGAATTTTGTAAAATGTTAATCCGGTACTCTGAATTCGTGTGCTTTTCCTTGTTTGTTTGCCTGGCTTGTTGTGAGTTTGTGATATAACATGTGCAGCTTTAGAAAGTACACATATGCTGTTTCCAGCTAGAAAAATTACGCGAGACCTCCAAAACCTTTTTAGTTCACATGAAGTGATACTGAACAAGAGCTTGCAGATTGAGTGCT


Protein sequences

Name Description Sequence
Zm.82520 translated coding region predicted by ESTScan from UniGene Zm.82520

MSCCGGAEEDSYGPPANQAVPPPNANAPGNRGGPRGPGAPRVGGPAKPVSIDVPAIPFDELKRITNNFSDRALIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQFATMGSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVKAITPLLNAPKPAAPAAPQS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF816
9-361 PTHR24420:SF816

EDSYGPPANQAVPPPNANAPGNRGGPRGPGAPRVGGPAKPVSIDVPAIPFDELKRITNNFSDRALIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQFATMGSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVKAITPLLNAPKPAAPAAP

HMMPanther: PTHR24420
9-361 PTHR24420,FAMILY NOT NAMED

EDSYGPPANQAVPPPNANAPGNRGGPRGPGAPRVGGPAKPVSIDVPAIPFDELKRITNNFSDRALIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQFATMGSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVKAITPLLNAPKPAAPAAP

superfamily: SSF56112
IPR011009
40-362 Kinase_like
Protein kinase-like domain

PRVGGPAKPVSIDVPAIPFDELKRITNNFSDRALIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQFATMGSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVKAITPLLNAPKPAAPAAPQ

Gene3D: G3DSA:3.30.200.20
53-144 G3DSA:3.30.200.20

VPAIPFDELKRITNNFSDRALIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQF

ProfileScan: PS50011
IPR000719
68-350 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDRALIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQFATMGSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVKAITPLL

HMMPfam: PF07714
IPR001245
73-344 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LIGEGSYGRVYNATLSDGRAAVIKKLDTSASQDSDTDFAAQIAMVSKLKNEYFLELLGYCLEDGNRMLTYQFATMGSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVK

PatternScan: PS00107
IPR017441
74-97 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYNATLSDGRAAVIKK

Gene3D: G3DSA:1.10.510.10
148-344 G3DSA:1.10.510.10

GSLHNILHGKKGVQGAEPGPVLNWAQRVKIAYGAARGLEYLHEKVQPSIVHRDIRSSNVLIFDDFSSKIADFNLTSQGTDTAARLHSTRVLGTFGYHAPEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLDSDYPPKAVAKLAAVAALCVQYESDFRPNMTIVVK

PatternScan: PS00109
IPR008266
196-208 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDIRSSNVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox