PRGDB00064299 (Zm.82594)

From PRG Wiki
Jump to: navigation, search
Zm.82594
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194707231 (BT042695)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0012N20 mRNA, complete cds

DNA Sequence

GTCACCGCGTGAGCTCAGGAGGAAGAGGGAGAAGGAGAGGCCGCCGGCGGCGGCGCGGCAGACCGGGAACCGCCGTGTAGCACTGGGGTGGTGGACCCGCGCGCCCATGCGTCGGTGAGGTGGTGGGGCCCGCTTGGCGCTCGAGTTGGAATGGCGGCGGCAGGGAGGTGGTGGGCGGTGGTCCTTGCGGTCGCGGTGCTGCTCTGGCCGGGCCGGGTCGTCGCCAACACCGAGGGCGATGCTCTATACAGCCTGCGGCAGAGCTTGATAGATACGAACAATGTCTTGCAGAGTTGGGATTCCACTCTTGTTAATCCATGTACATGGTTTCACGTTACGTGTAACAGCGATAACAGTGTTATCAGAGTTGACCTTGGAAATGCACAATTATCTGGCGTCCTAGTGCCACAGCTTGGTCAGCTGAAAAATCTCCAATATTTGGAGCTTTACAGCAACAAAATAAGTGGGGCAATACCCCCTGAACTGGGGAACCTGACTAACCTTGTCAGTTTGGATCTGTATATGAACAACTTCTCTGGCAATATCCCTGACCGCCTAGGGAATCTATTGAAGCTGCGTTTCCTACGTCTTAACAACAACAGCTTGGTTGGTCCCATTCCTGTAGCCTTGACCAATATCTCCACTCTCCAAGTACTGGATCTCTCGAGTAACAACCTCTCAGGACCAGTCTCATCCAATGGCTCCTTTTCACTCTTCACCCCTATAAGTTTTAACAATAATCCAAATCTTTGTGGCCCTGTTACTACGAAGCCCTGCCCTGGGGATCCTCCCTTTTCCCCACCGCCTCCATTCAATCCTCCGTCTCCTCCAACCCAATCAACTGGTGCTTCTGGCCCTGGAGCAATCGCTGGAGGTGTTGCTGCTGGTGCTGCATTGGTTTTTGCTGTTCCAGCAATTGCATTTGCAATGTGGCGCCGTCGTAAACCTGAAGAGCATTTCTTCGATGTTCCTGCCGAGGAGGATCCAGAAGTTCATCTTGGTCAGCTCAAAAAGTTTTCGTTGCGGGAGCTTCAAGTTGCTACTGATACTTTTAGTAACAAGCACATTTTAGGAAGAGGTGGTTTTGGAAAAGTGTACAAGGGAAGGCTTGCTGATGGCTCATTGGTAGCAGTGAAAAGACTAAAAGAGGAGCGCACACCTGGTGGTGAGCTTCAGTTTCAAACAGAGGTTGAGATGATTAGCATGGCAGTGCACAGGAACCTTCTCCGACTTCGTGGTTTCTGCATGACACCTACTGAACGGTTGCTGGTCTACCCATACATGGCTAATGGCAGTGTGGCATCACGTTTACGAGAGCGCCAGGCATCTGAACCACCTCTTAAATGGGAAACAAGAAGACGGATTGCACTGGGATCTGCAAGAGGTCTTTCTTACTTGCATGATCACTGCGATCCTAAGATCATCCATCGGGATGTCAAAGCTGCAAATATTCTTTTGGATGAGGAGTTTGAGGCAGTCGTAGGTGATTTCGGGCTTGCCAAGCTTATGGACTACAAGGATACCCATGTCACAACTGCTGTTCGTGGAACAATTGGACACATTGCTCCCGAGTACCTATCCACTGGCAAGTCCTCTGAAAAGACCGATGTTTTTGGATATGGGATCATGCTTCTGGAGCTTATTACTGGACAGAGGGCATTTGATCTAGCTCGTCTTGCAAATGATGATGATGTTATGCTTCTTGACTGGGTGAAAGGACTGCTGAAGGAGAAGAAGGTGGAGATGTTGGTGGACCCAGACCTACAGAATGCCTACGAGGAGATCGAGGTGGAGAACCTTATCCAGGTGGCACTCCTCTGCACGCAGGGCTCCCCGTTGGAGCGTCCAAAGATGTCGGAGGTGGTGAGGATGCTGGAAGGTGACGGCCTGGCAGAGCGTTGGGACGAATGGCAGAAAGTAGAGGTGGTGAGGCAGGAGGCTGAGTCGGCACCGCTCCGCAATGACTGGATCGTCGATTCCACGTACAACCTTCGTGCTGTGGAGCTGTCCGGTCCAAGGTAGTAGCCACTCCATGACTCCGATGAAAGAATTCAACACTGAATTGCCTAGATTCAGTCTAATTGCTGCTTGTGTATATGAAAGGTAGCTTTTGGAATTGTTAGCGGCAGTCAATATGAAGGGATGGtttttttttttATAATTCCTCGCTAGCCTCAGAAGTCGGGGGGTAGGCTGCAGTTGTGTTAAGGTGAAAATTCGTATACCCGAGGGTGAATTTTTAAAGCATTGTTGTAGTGGTTCGGGGAATGTAGCAGCGATCGTCCAATTGTACTACGTGCTATGAAGAACAGTGCTACCTTTTGGCC


Protein sequences

Name Description Sequence
Zm.82594 translated coding region predicted by ESTScan from UniGene Zm.82594

VTAXAQEEEGEGEAAGGGAADREPPCSTGVVDPRAHASVRWWGPLGARVGMAAAGRWWAVVLAVAVLLWPGRVVANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWFHVTCNSDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMNNFSGNIPDRLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPVSSNGSFSLFTPISFNNNPNLCGPVTTKPCPGDPPFSPPPPFNPPSPPTQSTGASGPGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLKKFSLRELQVATDTFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESAPLRNDWIVDSTYNLRAVELSGPRXXPLHDSDERIQH

Domains

Domain Start-End Description Sequence

Seg: seg
3-20 seg

AXAQEEEGEGEAAGGGAA

HMMPanther: PTHR24420
38-669 FAMILY NOT NAMED,FAMILY NOT NAMED

SVRWWGPLGARVGMAAAGRWWAVVLAVAVLLWPGRVVANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWFHVTCNSDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMNNFSGNIPDRLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPVSSNGSFSLFTPISFNNNPNLCGPVTTKPCPGDPPFSPPPPFNPPSPPTQSTGASGPGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLKKFSLRELQVATDTFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESAPLRNDWIVDSTYNLRAVEL

HMMPanther: PTHR24420:SF351
38-669 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SVRWWGPLGARVGMAAAGRWWAVVLAVAVLLWPGRVVANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWFHVTCNSDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMNNFSGNIPDRLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPVSSNGSFSLFTPISFNNNPNLCGPVTTKPCPGDPPFSPPPPFNPPSPPTQSTGASGPGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLKKFSLRELQVATDTFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESAPLRNDWIVDSTYNLRAVEL

Seg: seg
52-69 seg

AAAGRWWAVVLAVAVLLW

superfamily: SSF52058
72-259 L domain-like,LRR

RVVANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWFHVTCNSDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMNNFSGNIPDRLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPVSSNGSFSLFTPISFNNNPNLCGPVTTKPC

HMMPfam: PF08263
IPR013210
75-115 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
77-247 no description

TEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWFHVTCNSDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMNNFSGNIPDRLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPVSSNGSFSLFTPISFNNN

HMMPfam: PF12799
142-179 LRR_4,Leucine Rich repeats (2 copies)

KNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMNNFS

Seg: seg
185-202 seg

RLGNLLKLRFLRLNNNSL

Seg: seg
258-277 seg

PCPGDPPFSPPPPFNPPSPP

Gene3D: G3DSA:2.60.120.200
IPR013320
263-369 no description
Concanavalin A-like lectin/glucanase, subgroup

PPFSPPPPFNPPSPPTQSTGASGPGAIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLKKFSLRELQVATDTFSNKHILGRGGFGKVYKGR

Seg: seg
282-309 seg

GASGPGAIAGGVAAGAALVFAVPAIAFA

superfamily: SSF56112
IPR011009
323-648 Protein kinase-like (PK-like)
Protein kinase-like domain

VPAEEDPEVHLGQLKKFSLRELQVATDTFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAE

ProfileScan: PS50011
IPR000719
351-638 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRMLEGDGLAERWDEWQ

HMMSmart: SM00220
IPR002290
351-625 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRML

HMMSmart: SM00219
IPR020635
351-625 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRML

HMMPfam: PF00069
IPR017442
353-622 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVV

PatternScan: PS00107
IPR017441
357-379 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGSLVAVK

Gene3D: G3DSA:3.30.200.20
370-428 no description

LADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYM

Gene3D: G3DSA:1.10.510.10
429-625 no description

ANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQNAYEEIEVENLIQVALLCTQGSPLERPKMSEVVRML

PatternScan: PS00108
IPR008271
474-486 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox