PRGDB00064300 (Zm.82599)

From PRG Wiki
Jump to: navigation, search
Zm.82599
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238011035 (BT086200)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0128M21 mRNA, complete cds

DNA Sequence

CCGCTCCGCCGCCGGCACTCACCCCAGCTGCACTCCCGTGGGCCGTGCCGCCGTGGCACGCCGGCGCGGCGGATGCAGTCGCCACGAATCAGGACAAGCAGCAGGCGCCAAAACCCAAACCAATTCCCTCCCTTCCGTTCCTACTACGATACCCACCTCGACGCGCCGTCTCGCCGGCGACGTCACTGGCAAGTACCAAACTGCCCCTACCTCCTCCCGCTTAGTTCTATAAATACGGGGGGGTCGTCTTCCTCCACAAGATTCTGCCAAAAGATCCTCTCGGATgcccccgcccccgcccacccatttcgccagtcgccatcgagctctcgcttccgccgcccgctgccgcTCTATCACCCCGGTGCTGAGCCCTAGGATGTGACTGGCGGACGTCTCTATGGCCGAGCCGTAGGTGGAGGCGGCACCTCGGCGCCGTGGGAGATGGAGGACGATGACACCGAGGGTGTAGGCGAGAGCACCTGTCCCCCCGCCGCCGACCGAGGAGGCTCCTCCTcggccggcggcggcggcggcgACTCGCACAGTTACACTGACATAGAGAAGGAGGTCTTCGACCGTCTCATGGAGAAGAGAATCCCGGAGGTCGTCGCGGACCCGGTGGCCTTCCGCGAAGAGCTCCGCCGCCACTTCGAGCGCCTGCCGCTGAGCTACGCCGTCGATGTGAACGTCGACAAGGCGGAGGACGTGCTGCTGCACCGGAGGATTCTCAACGAGTGCGCTCACCCTGAAAATCGCCCCATCTTCCATGTGGGCTTCCTGAACTGCATCCCGCCCTCGGTGGATCCACAGTATAACACTCAGTCCATCTCTACGAGCGAAAACGGTAATTGTGGGGGTTCTCAGGATTCCACTTTGAGAAAATTTGAGCCATGCGAAGGGATCGAGGACCTCAGTTTAACTGGACAAAAAGTTGTGGTTGACTCTGTGGCCAGTTCTTCGAGGGGAGATGAAGAAATCCTCCATGTTCATGAAATTATTTTTTCTACCATTGACAAACCAAAGCTCCTCGCTCAGCTATCTGCTTTGTTGTCTGAAGTTGGACTGAACATCCGTGAAGCTCATGTCTTCTCAACGACTGATGGCTTTTGTTTGGATGTATTTGTTGTTGATGGCTGGGATACAAAGGAGACAGATACTTTGCTACAGATTCTCAAGGAGACAGCGGCACGAAATCATGCCTCATTATCAAACCCAACCAATTCTGCAGCCTCAGAAAGAGTACTGGAACTACAAGAGAAGATTGGTGATTCAAATATTGACAGGAATTTTCTGCAGATTGGGGAGAAGATTGCATCTGGATCTTCCGGGGACTTGCATCGAGGAACTTATCAAGGTATGGATGTTGCAGTAAAGTTCCTCAGAACCGAACATGTTAATGACTCGTCAAAGGTGGAGTTTTTACAAGAAATAATTATTCTAAAGAGTGTTAATCATGATAATGTTGTTCGATTCTACGGGGCATGCACAAAGCAGAGAAAATATGTCATCGTGACAGAGTATATGCCTGGAGGCAATCTGTATGATTTTCTTCACACGCTAAAAAATACTTTGGATCTCCCAACGGTTCTCAGGATTGCTATCGGCATCTCCAAGGGGATGGATTATTTGCACCAAAATAACATCATCCATCGGGACTTGAAGACTGCCAATTTGCTTATGGGCTCTGATTATGTTGTGAAGATTGCAGACTTTGGAGTCTCAAGGAATCCATCTCAAGGTGGAGACATGACTGCTGAAACTGGTACCTACAGATGGATGGCACCTGAGGTAATAAACCATAAGCCGTACGATCACAGGGCAGATATCTTCAGCTTTGCTGTGGTTCTGTGGGAGCTGGTCACTTCAAAGATACCATACAGAAATCTGACACCCTTGCAAGCTGCACTGGGAGTAAGGCAGGGAATGCGGTTGGAGATCCCGTCATGGGTCAATCCACAACTGTCTAAACTGATTCAGCGTTGCTGGGACGAAAATCCTAACCTGCGCCCCTCTTTCTCAGAGATCACTGCAGAGCTGGAAGGCATGTTAAGGGATCATCAGGCCTCCAAGGGAAGCAACAAACATTCGAAGGCAAAGGCACACAAAAAATCGCAGAGAGAGGCAGAATAACGAGGTTGTCAGTTACCACCTTGTGAAAAGCTTAGTGGAGCTTGGCTATCATCGTCCAAGATTCTGAGGCTACTACAAAGATGCTGCTAGTGTACAATTGTCAAATATTGTATATGATTGgtgtgtgtgtgtgtTTCTATTACTCCCAAAAACACTATATACGGGAGAAGCGTCGACAATACAGCGGGACAAGCAAAGACACGGAATCCTTGTACAAAATGGCTTGCAAGCAGCATAAAATGCCCTCTAGTTTTTGTATAC


Protein sequences

Name Description Sequence
Zm.82599 translated coding region predicted by ESTScan from UniGene Zm.82599

XRSAAGTHPSCTPVGRAAVARRRGGCSRHESGQAAGAKTQTNSLPSVPTTIPTSTRRLAGDVTGKYQTAPTSSRLVLXIRGGRLPPQDSAKRSSRMPPPPPTHFASRHRALASAARCRSITPVLSPXDVTGGRLYGRAVGGGGTSAPWEMEDDDTEGVGESTCPPAADRGGSSSAGGGGGDSHSYTDIEKEVFDRLMEKRIPEVVADPVAFREELRRHFERLPLSYAVDVNVDKAEDVLLHRRILNECAHPENRPIFHVGFLNCIPPSVDPQYNTQSISTSENGNCGGSQDSTLRKFEPCEGIEDLSLTGQKVVVDSVASSSRGDEEILHVHEIIFSTIDKPKLLAQLSALLSEVGLNIREAHVFSTTDGFCLDVFVVDGWDTKETDTLLQILKETAARNHASLSNPTNSAASERVLELQEKIGDSNIDRNFLQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELEGMLRDHQASKGSNKHSKAKAHKKSQREAE

Domains

Domain Start-End Description Sequence

Seg: seg
14-25 seg

VGRAAVARRRGG

Seg: seg
105-119 seg

ASRHRALASAARCRS

Seg: seg
131-143 seg

GGRLYGRAVGGGG

Seg: seg
170-184 seg

GGSSSAGGGGGDSHS

Seg: seg
211-222 seg

FREELRRHFERL

superfamily: SSF55021
327-399 ACT-like

EILHVHEIIFSTIDKPKLLAQLSALLSEVGLNIREAHVFSTTDGFCLDVFVVDGWDTKETDTLLQILKETAAR

HMMPfam: PF01842
IPR002912
332-390 ACT
Amino acid-binding ACT

HEIIFSTIDKPKLLAQLSALLSEVGLNIREAHVFSTTDGFCLDVFVVDGWDTKETDTLL

superfamily: SSF56112
IPR011009
405-690 Protein kinase-like (PK-like)
Protein kinase-like domain

SNPTNSAASERVLELQEKIGDSNIDRNFLQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELEGMLRDHQA

Gene3D: G3DSA:3.30.200.20
425-495 no description

DSNIDRNFLQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYG

HMMPanther: PTHR23257:SF82
428-702 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

IDRNFLQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELEGMLRDHQASKGSNKHSKAKA

HMMPanther: PTHR23257
428-702 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

IDRNFLQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELEGMLRDHQASKGSNKHSKAKA

ProfileScan: PS50011
IPR000719
433-685 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELEGML

HMMPfam: PF07714
IPR001245
433-681 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAEL

HMMSmart: SM00219
IPR020635
433-681 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAEL

HMMSmart: SM00220
IPR002290
433-685 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LQIGEKIASGSSGDLHRGTYQGMDVAVKFLRTEHVNDSSKVEFLQEIIILKSVNHDNVVRFYGACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELEGML

Gene3D: G3DSA:1.10.510.10
496-682 no description

ACTKQRKYVIVTEYMPGGNLYDFLHTLKNTLDLPTVLRIAIGISKGMDYLHQNNIIHRDLKTANLLMGSDYVVKIADFGVSRNPSQGGDMTAETGTYRWMAPEVINHKPYDHRADIFSFAVVLWELVTSKIPYRNLTPLQAALGVRQGMRLEIPSWVNPQLSKLIQRCWDENPNLRPSFSEITAELE

FPrintScan: PR00109
IPR001245
507-520 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYMPGGNLYDFLH

FPrintScan: PR00109
IPR001245
544-562 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHQNNIIHRDLKTANLLM

PatternScan: PS00108
IPR008271
550-562 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTANLLM

FPrintScan: PR00109
IPR001245
590-600 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
609-631 TYRKINASE
Serine-threonine/tyrosine-protein kinase

ADIFSFAVVLWELVTSKIPYRNL

FPrintScan: PR00109
IPR001245
652-674 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VNPQLSKLIQRCWDENPNLRPSF

Seg: seg
690-706 seg

ASKGSNKHSKAKAHKKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox