PRGDB00064301 (Zm.82908)

From PRG Wiki
Jump to: navigation, search
Zm.82908
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 189127517 (AY106302)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays PCO062261 mRNA sequence

DNA Sequence

GCACGAGGCCTCGCCCCACCCAGGGGCGGATCTCCACCCGGGGCTGCCTGGGCTGCAGCCCCTGTCGGCAGTCGCGGCCCAGTCCATCATCGCGCGACATGACCTAGCAGTAGCAGCAGACGTCCTACGTCCAGCCCCAGCCGCCGCCGTTTGGCTCCTGCGTTCGATCTCGCTGCGTCCTGGTCCTGCGCCCTGCGGTCCAGCCTCCTCTCCAAGACTCCACTTctccagcgcgctcacccgcgccagccgccaggccgccaccggccaccgccattggccccaccaTTTGCCGCTCCCGCCTACGATGCCGACGAGTGAGGTGTGGAGCTTGTCCGATTTCGAAATCAGCAAGTACATCGGTGAGGGCAGGTTCGGCAAGGTCTACCTCGCCCGCGAGAAGCAGAGCGGGTACGTGGTGGCGCTCAAGGTGATATTTAAGGCGAAACTGCAGAAGTACCACTTCCACGCGCACCTGCGGCGGGAGATCGAGATCCAGCAGAGTCTCGACCACCCTAACGTGCTCCGCCTCTTCACCTGGTTCCACGACGAAGAGCGAGTCGTCCTCGTCCTCGAGTACGCGGCCCGTGGCGAGCTCTACAAGGTCCTTCGCGCTGCTGGCCGCTTCACCGAGCGCACGTCCGCCACATATGTAGCGAGTCTTGCTGGTGCACTGGCATACTGTCACAAAAAGCAAGTCATTCATAGGGACATCAAGCCTGAGAATTTGCTAATCGACATCGAGGGCCGGCTTAAAATTGCAGATTTTGGATGGGCGGCTCGTTCAAATGCTAAACGCCACACACTCTGTGGCACAATCGATTATCTGGCACCAGAGATGGTAGAGAAAAAAGCTCATGACCATGCTGTGGACAACTGGACATTAGGAATCCTGTGCTATGAGTTCTTATATGGTTCACCTCCTTTTGAAGCTGATGAACAGGATGATACCTTGAGAAGGATAGTTAGGGTGGATTTGGCATTCCCTTCATCTCCTTGTGTATCTTCAGAGGCTAAGGATCTCATTTCCAAGCTTCTAGTTAAGGATTCAAGCAAGAGGCTTTGCCTTGAAGACATCATGAAGCATCCATGGATAAAGAAGAATGCAGACCCTTCAGGCAGTTGCATTAAGCAAAAAGATGTCACAAGATCAAAGCTTCTGTAATATCAGTACAACCTGCTTGCCAGTGGGCAAGAATCTTCTGATGTGGTGCCAAACTCGTCACTACTGGAGGACAAATATGATGACCTGTTGTAGTTTTAAGTTCCGATAGTTCTGGAGTGGATTGgtgtgtgtgtgtATCCCTGCAAGCTTTCTCCTACAGGCTGGAGTTCTAGTTCTGATGCAGCGTTTGTGTTTCCCTTTTGAACTGAGTGGTGAAACCAATGTTCACTGGAGAGGAATGTAGTTTTCAACTGAGTTGTTGAACCTTCGCGAATTGGAGGGTCAATGGTCTGTGGAGATTGGAGAGGAACGTGGCTTTCGCTGTGGCGATCGTATTTTGTAATTGTCGAATCTACAGTATTTTGGTCTTTAGCAATGAAATATGGAGATGCCCGTAGTTTTTCTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.82908 translated coding region predicted by ESTScan from UniGene Zm.82908

XHEASPHPGADLHPGLPGLQPLSAVAAQSIIARHDLAVAADVLRPAPAAAVWLLRSISLRPGPAPCGPASSPRLHFSSALTRASRQAATGHRHWPHHLPLPPTMPTSEVWSLSDFEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWIKKNADPSGSCIKQKDVTRSKLL

Domains

Domain Start-End Description Sequence

Seg: seg
35-50 seg

DLAVAADVLRPAPAAA

Seg: seg
60-73 seg

RPGPAPCGPASSPR

Seg: seg
95-106 seg

PHHLPLPPTMPT

superfamily: SSF56112
IPR011009
101-373 Protein kinase-like (PK-like)
Protein kinase-like domain

PPTMPTSEVWSLSDFEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWIKKNADPS

HMMPanther: PTHR24350
110-384 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE IAL-RELATED

WSLSDFEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWIKKNADPSGSCIKQKDVTR

Gene3D: G3DSA:3.30.200.20
111-212 no description

SLSDFEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTE

ProfileScan: PS50011
IPR000719
115-366 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWI

HMMPfam: PF00069
IPR017442
115-366 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWI

HMMSmart: SM00220
IPR002290
115-366 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWI

HMMSmart: SM00219
IPR020635
115-366 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FEISKYIGEGRFGKVYLAREKQSGYVVALKVIFKAKLQKYHFHAHLRREIEIQQSLDHPNVLRLFTWFHDEERVVLVLEYAARGELYKVLRAAGRFTERTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWI

PatternScan: PS00107
IPR017441
121-148 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGRFGKVYLAREKQSGYVVALKVIFK

Gene3D: G3DSA:1.10.510.10
213-380 no description

RTSATYVASLAGALAYCHKKQVIHRDIKPENLLIDIEGRLKIADFGWAARSNAKRHTLCGTIDYLAPEMVEKKAHDHAVDNWTLGILCYEFLYGSPPFEADEQDDTLRRIVRVDLAFPSSPCVSSEAKDLISKLLVKDSSKRLCLEDIMKHPWIKKNADPSGSCIKQK

PatternScan: PS00108
IPR008271
234-246 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKPENLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox