PRGDB00064302 (Zm.82954)

From PRG Wiki
Jump to: navigation, search
Zm.82954
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238007105 (BT084235)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0091N12 mRNA, complete cds

DNA Sequence

GAAACCAAGAAAAGCTCCTAGTCCTAGGTTGGAGCGGTTGCGTTGTGCTAGCTACACTAGATTCTAGCTAGAGAGCTAGTAGCTACTTGCATTAGGCTACTAGCCGGCCATGGGTTGCTGCCGCACCGGCGTCCACTGCGGTGCTGGACCGAGAAGAAACCAACTGCGGCGATGTTGGGGTGGTGGGGGCTCGCTCGTGCTGCTATTGCTGCTGGTGGCGGTGGCGGTGCCGGCGCGAGGGCAGCGGTCGGACGGCGTGGTGATCGCGCAGGCGGACCTGCAGGGGCTGCAGGCCATCCGCCAGGCGCTGGTGGACCCGCGCGGGTTCCTGGCCGGCTGGAACGGCACGGGCCTCGACGCCTGCTCCGGCGGCTGGACGGGGATCAAGTGCGCGCGGGGCAAGGTCGTGGCCATCCAGCTCCCTTTCAAGGGCCTTGCCGGCGCGCTCTCCGACAAGGTCGGCCAGCTCGCCGCGCTCCGGAGGCTCAGCTTCCACGACAACATCATCGGCGGCCAGGTGCCCGCCGCGCTCGGCTTCCTCCGGGAGCTCCGCGGCGTCTACCTCCACAACAACCGCTTCGCCGGTGCCGTGCCTCCGGCGCTCGGCGCCTGCGCGCTCCTGCAGACGCTCGACCTCAGCGGCAACTCTCTCTCGGGGAGTATCCCTTCCGCCCTGGCCAATGCCACTCGCCTCTATAGGGTCAACCTCGCGTACAACAACCTCTCCGGTGTCGTGCCGGCCAGCCTCACTTCCCTCCCGTTCCTCGAATCCCTTCAGCTCAACAACAACAATCTCAGCGGCGTAATTCCGCTCACCGTTGGCAGTCTCAGATTGCTCCACGATCTTTCTCTCGCTAGCAATTTGATCGGTGGAAGCATCCCGGATGGGATTGGCAACGCCACAAAGCTCAGAAACCTTGATCTCTCTGACAACCTTTTAGGTGGTAGCCTCCCTGAGTCACTCTGCAACCTCACTTTGTTAGTGGAGCTCGATCTCGACGGGAACGACATTGGTGGACACATCCCGGCATGCTTTGACGGGTTCAGGAATCTGACCAAGCTGTCCATGAGGAGGAATGTCCTCGACGGCGAAATCCCGGCGACTGTCGGGAACCTCTCGGCACTGTCACTGTTCGACGTGTCTGAGAACAACCTCACCGGAGAAATTCCGACCTCCTTGAGTGGCCTTGTCAATCTCGGTTCTTTCAATGTGTCCTACAACAATCTCTCGGGACCTGTGCCTGCAGCTCTCTCCAACAAGTTCAATTCTAGCTCGTTCGTTGGAAACCTTCAGCTCTGTGGCTTCAATGGCTCTGCCATTTGCACTTCTGTTTCATCTCCGCTCGTGGCGCCGTCCCCTCCACTGCCTTTGTCAGAGCGGCGAACCCGGAAGCTCAACAAAAAGGAGCTCATCTTTGCGGTAGCTGGCATCCTCCTGCTCTTCTTTCTACTGTTCTGCTGCGTCTTCATCTTCTGGAGGAAAGACAAGAAGGAAAGCTCGCCCCCCAAGAAGGGCGCCAAGGACGTGACCACCAAGACTGTCGGGAAGGCCGGCACTGGCACAGGCAAAGGCACCGACACCGGCGGGGACGGCGGCGGCAAGCTGGTGCACTTCGACGGGCCGCTCTCGTTCACAGCGGACGATCTGCTGTGCGCGACCGCGGAGATCCTCGGGAAGAGCACGTACGGGACGGTGTACAAGGCAACCATGGAGGACGGCAGCTACGTCGCGGTGAAGCGGCTCCGGGAGAAGATCGCCAAGAGCCAGAAGGAGTTCGAGCCGGAGGTGAACGCACTCGGCAAGCTCCGGCACCCCAACCTCCTCGCGCTCAGGGCCTATTACTTGGGACCCAAAGGCGAGAAGCTTCTGGTGTTCGACTACATGCCCAAAGGCAACCTTGCTTCTTTCCTCCATGCTCGTGCACCGGACAGCAGCCCGGTGGACTGGCCGACGAGGATGAACATCGCGATGGGCCTTGCGCGGGGATTGCACCACCTACACACCGACGCCAACATGGTGCACGGCAACATCACCAGCAACAACATCCTCCTGGACGAGGGGAACGACGCCAAGATCGCCGACTGCGGCCTGTCGCGCCTCATGAGCGCGGCAGCCAACTCCAGCGTGATCGCCGCCGCGGGCGCGCTCGGCTACCGCGCGCCCGAGCTCTCCAAGCTGAAGAAGGCCAACACCAAAACCGACATCTACAGCCTCGGGGTGGTCATGCTCGAGCTCCTGACCGGCAAGTCGCCCGGGGACACGACCAACGGCCTCGACCTGCCGCAGTGGGTGGCCTCGGTCGTCGAGGAGGAGTGGACCAACGAGGTGTTCGACCTGGAGCTCATGAAGG


Protein sequences

Name Description Sequence
Zm.82954 translated coding region predicted by ESTScan from UniGene Zm.82954

XKPRKAPSPRLERLRCASYTXILARELVATCIRLLAGHGLLPHRRPLRCWTEKKPTAAMLGWWGLARAAIAAGGGGGAGARAAVGRRGDRAGGPAGAAGHPPGAGGPAGFLAGWNGTGLDACSGGWTGIKCARGKVVAIQLPFKGLAGALSDKVGQLAALRRLSFHDNIIGGQVPAALGFLRELRGVYLHNNRFAGAVPPALGACALLQTLDLSGNSLSGSIPSALANATRLYRVNLAYNNLSGVVPASLTSLPFLESLQLNNNNLSGVIPLTVGSLRLLHDLSLASNLIGGSIPDGIGNATKLRNLDLSDNLLGGSLPESLCNLTLLVELDLDGNDIGGHIPACFDGFRNLTKLSMRRNVLDGEIPATVGNLSALSLFDVSENNLTGEIPTSLSGLVNLGSFNVSYNNLSGPVPAALSNKFNSSSFVGNLQLCGFNGSAICTSVSSPLVAPSPPLPLSERRTRKLNKKELIFAVAGILLLFFLLFCCVFIFWRKDKKESSPPKKGAKDVTTKTVGKAGTGTGKGTDTGGDGGGKLVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELMKX

Domains

Domain Start-End Description Sequence

Seg: seg
66-113 seg

ARAAIAAGGGGGAGARAAVGRRGDRAGGPAGAAGHPPGAGGPAGFLAG

Gene3D: G3DSA:3.80.10.10
107-281 no description

PAGFLAGWNGTGLDACSGGWTGIKCARGKVVAIQLPFKGLAGALSDKVGQLAALRRLSFHDNIIGGQVPAALGFLRELRGVYLHNNRFAGAVPPALGACALLQTLDLSGNSLSGSIPSALANATRLYRVNLAYNNLSGVVPASLTSLPFLESLQLNNNNLSGVIPLTVGSLRLLH

HMMPanther: PTHR24420
107-784 FAMILY NOT NAMED,FAMILY NOT NAMED

PAGFLAGWNGTGLDACSGGWTGIKCARGKVVAIQLPFKGLAGALSDKVGQLAALRRLSFHDNIIGGQVPAALGFLRELRGVYLHNNRFAGAVPPALGACALLQTLDLSGNSLSGSIPSALANATRLYRVNLAYNNLSGVVPASLTSLPFLESLQLNNNNLSGVIPLTVGSLRLLHDLSLASNLIGGSIPDGIGNATKLRNLDLSDNLLGGSLPESLCNLTLLVELDLDGNDIGGHIPACFDGFRNLTKLSMRRNVLDGEIPATVGNLSALSLFDVSENNLTGEIPTSLSGLVNLGSFNVSYNNLSGPVPAALSNKFNSSSFVGNLQLCGFNGSAICTSVSSPLVAPSPPLPLSERRTRKLNKKELIFAVAGILLLFFLLFCCVFIFWRKDKKESSPPKKGAKDVTTKTVGKAGTGTGKGTDTGGDGGGKLVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELMK

HMMPanther: PTHR24420:SF863
107-784 SUBFAMILY NOT NAMED

PAGFLAGWNGTGLDACSGGWTGIKCARGKVVAIQLPFKGLAGALSDKVGQLAALRRLSFHDNIIGGQVPAALGFLRELRGVYLHNNRFAGAVPPALGACALLQTLDLSGNSLSGSIPSALANATRLYRVNLAYNNLSGVVPASLTSLPFLESLQLNNNNLSGVIPLTVGSLRLLHDLSLASNLIGGSIPDGIGNATKLRNLDLSDNLLGGSLPESLCNLTLLVELDLDGNDIGGHIPACFDGFRNLTKLSMRRNVLDGEIPATVGNLSALSLFDVSENNLTGEIPTSLSGLVNLGSFNVSYNNLSGPVPAALSNKFNSSSFVGNLQLCGFNGSAICTSVSSPLVAPSPPLPLSERRTRKLNKKELIFAVAGILLLFFLLFCCVFIFWRKDKKESSPPKKGAKDVTTKTVGKAGTGTGKGTDTGGDGGGKLVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELMK

superfamily: SSF52058
148-435 L domain-like,LRR

GALSDKVGQLAALRRLSFHDNIIGGQVPAALGFLRELRGVYLHNNRFAGAVPPALGACALLQTLDLSGNSLSGSIPSALANATRLYRVNLAYNNLSGVVPASLTSLPFLESLQLNNNNLSGVIPLTVGSLRLLHDLSLASNLIGGSIPDGIGNATKLRNLDLSDNLLGGSLPESLCNLTLLVELDLDGNDIGGHIPACFDGFRNLTKLSMRRNVLDGEIPATVGNLSALSLFDVSENNLTGEIPTSLSGLVNLGSFNVSYNNLSGPVPAALSNKFNSSSFVGNLQLCG

HMMSmart: SM00369
IPR003591
181-205 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRELRGVYLHNNRFAGAVPPALGAC

HMMPfam: PF00560
IPR001611
208-227 LRR_1
Leucine-rich repeat

LQTLDLSGNSLSGSIPSALA

HMMSmart: SM00369
IPR003591
253-276 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPFLESLQLNNNNLSGVIPLTVGS

HMMPfam: PF13516
253-268 LRR_6,Leucine Rich repeat

LPFLESLQLNNNNLSG

Seg: seg
256-267 seg

LESLQLNNNNLS

HMMSmart: SM00369
IPR003591
277-301 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRLLHDLSLASNLIGGSIPDGIGNA

Gene3D: G3DSA:3.80.10.10
282-420 no description

DLSLASNLIGGSIPDGIGNATKLRNLDLSDNLLGGSLPESLCNLTLLVELDLDGNDIGGHIPACFDGFRNLTKLSMRRNVLDGEIPATVGNLSALSLFDVSENNLTGEIPTSLSGLVNLGSFNVSYNNLSGPVPAALSN

HMMPfam: PF13855
303-360 LRR_8,Leucine rich repeat

KLRNLDLSDNLLGGSLPESLCNLTLLVELDLDGNDIGGHIPACFDGFRNLTKLSMRRN

Seg: seg
306-318 seg

NLDLSDNLLGGSL

HMMSmart: SM00369
IPR003591
325-348 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTLLVELDLDGNDIGGHIPACFDG

HMMSmart: SM00369
IPR003591
397-420 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVNLGSFNVSYNNLSGPVPAALSN

Seg: seg
444-459 seg

SVSSPLVAPSPPLPLS

Seg: seg
471-492 seg

LIFAVAGILLLFFLLFCCVFIF

Seg: seg
504-535 seg

KKGAKDVTTKTVGKAGTGTGKGTDTGGDGGGK

superfamily: SSF56112
IPR011009
529-768 Protein kinase-like (PK-like)
Protein kinase-like domain

GGDGGGKLVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASV

ProfileScan: PS50011
IPR000719
552-785 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

CATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELMKX

HMMSmart: SM00220
IPR002290
552-783 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

CATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELM

HMMSmart: SM00219
IPR020635
552-783 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

CATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELM

Gene3D: G3DSA:3.30.200.20
555-614 no description

AEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAY

HMMPfam: PF07714
IPR001245
555-755 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

AEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEPEVNALGKLRHPNLLALRAYYLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDT

Gene3D: G3DSA:1.10.510.10
615-766 no description

YLGPKGEKLLVFDYMPKGNLASFLHARAPDSSPVDWPTRMNIAMGLARGLHHLHTDANMVHGNITSNNILLDEGNDAKIADCGLSRLMSAAANSSVIAAAGALGYRAPELSKLKKANTKTDIYSLGVVMLELLTGKSPGDTTNGLDLPQWVA

Seg: seg
703-716 seg

SAAANSSVIAAAGA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox