PRGDB00064303 (Zm.83030)

From PRG Wiki
Jump to: navigation, search
Zm.83030
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 85540214 (BT023963)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Zea mays

Comment?

Zea mays clone EL01N0413F10 mRNA sequence

DNA Sequence

CGGCACGAGGGCTTGATGACAATCGTATTGGCGGAGACATACCAGCCTCTATTGCCAACCTCTCAAAGCTGCAGACGCTTGACCTGTCGTCCAACAATCTTACCGGCAGCATCCCTGCATCGTTGGCTCAGATTCCTGGCCTTGTGTCATTCAATGTGTCACACAACGAGCTGTGGGGTGAGATACCGGCAATGCTCGGCTCCCGCTTTGGTTCTGCTTCAGCGTATGCTTCAAACCCAGATTTGTGTGGGCCGCCATTGGAGAGTGAGTGCGGAGAGCANCGGCGGCGGCAGAGACGGCAGAAGGTGCAGCGCCTGGCTctgctaattggtgtggtggctgctgccgtgctgctccttgcgctgttgtgctgttgctgcgtgTTTAGCTTGCTGCGATGGAGGCGTCGGTTCATTGAGAGCCGTGATGGTGTGAAGAAGAGGAGACGCAGCCCGGGACGCGGCAGTGGGTCGAGTGGCACAAGCACGGAGAACGGTGTCAGCCAGCCGAGGCTGATTATGTTCAACTCAAGGATCACTTATGCCGACACTGTTGAGGCAACCCGCCAGTTTGACGAGGCGTTTGTGCTCAGCCGAGGCCGCCATGGCCTCGTGTTCAAGGCTTGTTACAGTGACGGCACCGTGCTGGCGATTCTGCGGCTCCCGTCCACGTCTGCGGATGGTGCCGTGGTGATTGATGAAGGGTCGTTCAGGAAAGAGGCCGAGTCTCTCGGGAAGGTGAAGCACAGGAACCTGACTGTGCTCCGTGGCTACTACGCCGGTCCTCCGCCGGATGTCCGGCTGCTGGTCTACGACTACATGCCCAACGGCAACCTCGCCACGTTGCTGCAGGAAGCGTCGCACCAGGACGGGCACATCCTCAACTGGCCAATGAGGCACCTCATCGCGCTGGGCGTCTCGCGCGGCCTTGCGTTCCTGCATCAGTCCGGCGTCGTGCACGGCGACGTGAAGCCGCAGAACATCCTCTTCGACGCCGACTTCGAGCCGCACCTGTCGGACTTCGGCCTGGAGCCGATGGTGGTGACCGCGGGTGCCGCCGCGGCAGCCGCCGCCGCGTCGACATCAGCTGCGACACCCGTGGGCTCGCTCGGGTACGTCGCCCCCGACGCGGCCGCGGCCGGGCAGGCCACGAGGGAAGGCGACGTGTACAGCTTCGGCATCGTGCTGCTGGAGCTCCTGACGGGCCGGCGCCCCGGCATCTTCGCCGGGGAGGAGGAGGACATCGTGAAGTGGGTGAAGCGGCAGCTGCAGCGCGGCGCCGTGGCGGAGCTGCTGGAGCCGGGCCTGCTGGAGCTGGACCCGGAGTCCTCCGAGTGGGAGGAGTTCCTGCTGGGCATCAAGGTCGGGCTGCTCTGCACCGCGTCGGACCCGCTGGACCGCCCGGCCATGGGCGACGTGGTGTTCATGCTGGAGGGCTGCCGCGTCGGCCCGGACATCCCGTCCTCCGCCGACCCCACCTCCCAGCCGTCGCCGGCCTGATCTCCCGTCGGCCCACGGCCGGCACTGCCGCCTGTCAGATTCAATTCGGTAGCTTGTTCCAttttttttCTCTCTTTCGATGATTGTTTTTTCCCCTTAATTAGTTCAGATAATTAGTGGTAGTCTCATCTATGCCTGCCGGCGTGCGGCCGTCGACGGACGAACTGATCCGTGAGGCCGGGAACCGTTTCCCGCCAAGGAAGGAACTAGCCGTTGGGCGTCTCGTTTGGTTAGCGGAGGCGTACGGCCCCGGGCATGGGGAGGGAGCAAGGAACCATGTGGCGCACTGCTCAGAGGCGCTTGGCACGGCCTGATGGCAGGCCCCTGCCATGCCAAGCCCAAAGCGTGTCGTGGTGCTGCGCATGTGGGGTCCCCCTGCCCAGGCATCGGCAACGGCTACTGATGCCGGACATGGCTGTCGCCTCCTGGCCACTGATCTCGGCCGATCTGTACCACGACCACGACCCATGTACTCTCTAGAGGGGCCTGCTTGGCTTCCTGGGATCCTGTCTTTAATCTTGTTTCCCCAAACCAACAACGACCTCTTTGTGCCATGTGCTGTCCaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.83030 translated coding region predicted by ESTScan from UniGene Zm.83030

XARGLDDNRIGGDIPASIANLSKLQTLDLSSNNLTGSIPASLAQIPGLVSFNVSHNELWGEIPAMLGSRFGSASAYASNPDLCGPPLESECGEXRRRQRRQKVQRLALLIGVVAAAVLLLALLCCCCVFSLLRWRRRFIESRDGVKKRRRSPGRGSGSSGTSTENGVSQPRLIMFNSRITYADTVEATRQFDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTSQPSPAXSPVGPRPALPPVRFNSVACSIFFLSFDDCFFPLISSDNXVVVSSMPAGVRPSTDELIREAGNRFPPRKELAVGRLVWLAEAYGPGHGEGARNHVAHCSEALGTAXWQAPAMPSPKRVVVLRMWGPPAQASATATDAGHGCRLLATDLGRSVPRPRPMYSLEGPAW

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
5-68 no description

LDDNRIGGDIPASIANLSKLQTLDLSSNNLTGSIPASLAQIPGLVSFNVSHNELWGEIPAMLGS

superfamily: SSF52058
5-91 L domain-like,LRR

LDDNRIGGDIPASIANLSKLQTLDLSSNNLTGSIPASLAQIPGLVSFNVSHNELWGEIPAMLGSRFGSASAYASNPDLCGPPLESEC

HMMPanther: PTHR24420:SF687
5-545 SUBFAMILY NOT NAMED

LDDNRIGGDIPASIANLSKLQTLDLSSNNLTGSIPASLAQIPGLVSFNVSHNELWGEIPAMLGSRFGSASAYASNPDLCGPPLESECGEXRRRQRRQKVQRLALLIGVVAAAVLLLALLCCCCVFSLLRWRRRFIESRDGVKKRRRSPGRGSGSSGTSTENGVSQPRLIMFNSRITYADTVEATRQFDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTSQPSPAXSPVGPRPALPPVRFNSVACSIFFLSFDDCFFPLISSDNXVVVSSM

HMMPanther: PTHR24420
5-545 FAMILY NOT NAMED,FAMILY NOT NAMED

LDDNRIGGDIPASIANLSKLQTLDLSSNNLTGSIPASLAQIPGLVSFNVSHNELWGEIPAMLGSRFGSASAYASNPDLCGPPLESECGEXRRRQRRQKVQRLALLIGVVAAAVLLLALLCCCCVFSLLRWRRRFIESRDGVKKRRRSPGRGSGSSGTSTENGVSQPRLIMFNSRITYADTVEATRQFDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTSQPSPAXSPVGPRPALPPVRFNSVACSIFFLSFDDCFFPLISSDNXVVVSSM

HMMPfam: PF13855
5-58 LRR_8,Leucine rich repeat

LDDNRIGGDIPASIANLSKLQTLDLSSNNLTGSIPASLAQIPGLVSFNVSHNEL

ProfileScan: PS51450
23-45 LRR,Leucine-rich repeat profile.

KLQTLDLSSNNLTGSIPASLAQI

Seg: seg
94-105 seg

XRRRQRRQKVQR

Seg: seg
106-132 seg

LALLIGVVAAAVLLLALLCCCCVFSLL

Seg: seg
148-160 seg

RRRSPGRGSGSSG

superfamily: SSF56112
IPR011009
163-500 Protein kinase-like (PK-like)
Protein kinase-like domain

TENGVSQPRLIMFNSRITYADTVEATRQFDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTSQPSPAX

Gene3D: G3DSA:3.30.200.20
178-273 no description

RITYADTVEATRQFDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDY

ProfileScan: PS50011
IPR000719
191-486 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFMLEGCRVGPDI

HMMSmart: SM00219
IPR020635
191-477 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFML

HMMSmart: SM00220
IPR002290
191-470 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDEAFVLSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAM

HMMPfam: PF00069
IPR017442
197-411 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LSRGRHGLVFKACYSDGTVLAILRLPSTSADGAVVIDEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGE

Gene3D: G3DSA:1.10.510.10
274-494 no description

MPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSAATPVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGIFAGEEEDIVKWVKRQLQRGAVAELLEPGLLELDPESSEWEEFLLGIKVGLLCTASDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTS

PatternScan: PS00108
IPR008271
318-330 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHGDVKPQNILF

Seg: seg
349-365 seg

TAGAAAAAAAASTSAAT

Seg: seg
430-445 seg

ELLEPGLLELDPESSE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox