PRGDB00064304 (Zm.83103)

From PRG Wiki
Jump to: navigation, search
Zm.83103
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223943202 (BT060988)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0081I24 mRNA, complete cds

DNA Sequence

ACACACTATACTAGTGAGCAAATAAAGCCACCGATGTCATCACTCCTGTTGCGAGTGCTGCTCATCCAGCTTGCAGCAGTGGAGTGCCTCTCCGCCGCGATTCCAGGCTGCCTAACGCAATGTGGAGGCGTAGAGATACCCTATCCATTCGGCGTCGGCACCAACTGCTCCCGCAAAGGGTTCCGGATCAAGTGCATCAACGGCAGCGCGGGCGAGGAGATTCCAGTGCTGCTACCTACTACGCGCTACCAGAACATCCGGGTGCTGAACCTGTCCGTGTCGCCGTTGCCGGAGGCTCGAGTGCTTCTTCCGGTGGCATGGCAGTGCTTCAACGCCACCGGGGGCGTCACTGGGATCTACTCGGGAGATGTGGACTTCAACCCAGAGGGCGTATACCGCATCTCCAACACACAGAACGAGCTCTTCGTCCTCGGCTGCGACACCTATGCGTTCACCAAAGGCGTGAGGGTGCACAACGTTAACGCACGCTTCCCTTACAGATACTTCACGGGGTGTATCACCGTCAGTGTAGACGACAAGGACCCGCGCGACGGTGCCTGCGCGGGCCTCGGCTGCTGCCGCGTCGACATCCCGCCAGGCATCACGGACACCAGCATGACCTTCTCGTCTACCTGGACGCGTGCCAACCAGACCTTCTGCCCCTGCGACTACGCCTTCATCGTGGAGAAGGGCAACTACACCTTCAAGGCATCCGACCTTGTGTCGCACACACCCGACAACCGTCTGCCTTTGGACTGGTGGACCATGCCACTGCGTCTCGACTGGGCCATCCGCGACAACAACGGCGACTCCATGACTTCCATCTCCTGCGCCCAGGCACCCAACGAACCTGACTATGGCTGCCGCAGCAAGCATAGCGAGTGCACTAATTCAACCAATGGCCCTGGCTACTTCTGCAAGTGTGCCCATGGCTACGACGGAAACCCCTATGTCCAGAGTGATGGTGAATGCACGAATATCAACGAGTGCCAAGATCCAAAGTCACATAATTGTTCAAGTGGCAGCAAATGCATTGACACAGACGGAGGCTATTATTGTCAATGCAATTTCTTCCGAAGAGGGCAGCAATGTGATCCCTTAATTCCTATGGCTGCCGTTGCACTGTTAACAACATTTGCTGCCGTCGTCCTTGGATGTGTCGCAATTGTTTTGCTTCAGACTCTAAACAACAGGAAAAGATTCAACAGAAATGGAGGTAAACTACTGAATGCCCAGGGCATAACCACCTACACCAAAAGGGAGCTGAAGAAGATAACTAATGGCTACAGCAAACGCCTTGGAGGAGGGCACTTTGGCAATGTTTACGAGGGCACCATCGTCGACGGCAGAAAGGTCGCCGTCAAATGTCCTTTGCGGACAAGGGTGTCGTCGCACCGCTGCCATTGGAAGAATTTGATTCGACCTCGCCGTGTACCGCTACCGCAACAGAGGGTGGAGGAAGATGGGTCGTTCATGAACGAGATCAGGTTCCAGTTCGAAGTCAGTCGTCACAAGAACTTGGTCCAGCTCCTGGGATGCTGCCTAGAGACCGACATTCCGATCCTAGTCTTCGAGTTTGTCGCCAATGGAAGCCTGGAGGACATACTTCATAGTGCCAAGAAACCATGTACCCTCTCGCTGCCGGAGCGGCTGGACATCGCCATTGGCTCCGCGGAAGCTATCGCCTACATGCACTCCCTTGACAATCAAAAGCGTGTCCATGGAGACATCAAGCCTTCCAACATCCTCCTTGACGATGACCTCAATCCAAAAGTCTCTGACTTTGGTTCCTCCAAGCTCCTGGCAATCCATAGCTACTACGTTAGGGCAGTGGCTGCAGATATAGGCTACATGGACCCATTATATATGAAGACCGAGCACTTCACATTGGAGTGCGATGTCTACAGCTTCGGCGTGGTGCTTCTGGAGCTCATCACGAGGAGAAGGGCCAGCTGGTATGAACAAGATCACCAAGGGAACAAGATCCTCCCCATCGAGTTCGTCAAGTGCTTCAAGGACCACGGTAGCGGATGTGCGATGTATGATAGCAGACTTGATTTCTCAGCTGGCGAGGATGCTCAATCTCGATGCAACAAGCGTTGCCTCGACATGATTGGCATGTTGGCCGTCCGATGCCTCAAGGAAGACAAGAGGGAGAGGCCAACCATGGCAGAGGTTGTCGAGGAGCTTAAGCGAGTGAAGGTACTACTGCTGGGTACACATATATAAAATAATGGCCTGCAGCAATCAAGCGAGTTCGAAGCACGCAGATGAATGGAAGCGAAGCAAGCAATAAGAATGGTCGGTCAGCACATGTGAAGCGCTGAACATGGCGGCGGTACTGATACAAGCAATAATAAGGGTTCCTCAACTCAAATAAATATACATGATTTATTCTCTTCCAATAAAACAGCAATGTCTATCTGT


Protein sequences

Name Description Sequence
Zm.83103 translated coding region predicted by ESTScan from UniGene Zm.83103

THYTSEQIKPPMSSLLLRVLLIQLAAVECLSAAIPGCLTQCGGVEIPYPFGVGTNCSRKGFRIKCINGSAGEEIPVLLPTTRYQNIRVLNLSVSPLPEARVLLPVAWQCFNATGGVTGIYSGDVDFNPEGVYRISNTQNELFVLGCDTYAFTKGVRVHNVNARFPYRYFTGCITVSVDDKDPRDGACAGLGCCRVDIPPGITDTSMTFSSTWTRANQTFCPCDYAFIVEKGNYTFKASDLVSHTPDNRLPLDWWTMPLRLDWAIRDNNGDSMTSISCAQAPNEPDYGCRSKHSECTNSTNGPGYFCKCAHGYDGNPYVQSDGECTNINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCDPLIPMAAVALLTTFAAVVLGCVAIVLLQTLNNRKRFNRNGGKLLNAQGITTYTKRELKKITNGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEELKRVKVLLLGTHI

Domains

Domain Start-End Description Sequence

Seg: seg
15-24 seg

LLLRVLLIQL

HMMPfam: PF13947
IPR025287
35-148 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

PGCLTQCGGVEIPYPFGVGTNCSRKGFRIKCINGSAGEEIPVLLPTTRYQNIRVLNLSVSPLPEARVLLPVAWQCFNATGGVTGIYSGDVDFNPEGVYRISNTQNELFVLGCDT

HMMPanther: PTHR24420:SF444
256-733 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MPLRLDWAIRDNNGDSMTSISCAQAPNEPDYGCRSKHSECTNSTNGPGYFCKCAHGYDGNPYVQSDGECTNINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCDPLIPMAAVALLTTFAAVVLGCVAIVLLQTLNNRKRFNRNGGKLLNAQGITTYTKRELKKITNGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEELKRV

HMMPanther: PTHR24420
256-733 FAMILY NOT NAMED,FAMILY NOT NAMED

MPLRLDWAIRDNNGDSMTSISCAQAPNEPDYGCRSKHSECTNSTNGPGYFCKCAHGYDGNPYVQSDGECTNINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCDPLIPMAAVALLTTFAAVVLGCVAIVLLQTLNNRKRFNRNGGKLLNAQGITTYTKRELKKITNGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEELKRV

HMMSmart: SM00181
IPR006210
276-325 Epidermal growth factor-like domain.
Epidermal growth factor-like

SCAQAPNEPDYGCRSKHSECTNSTNGPGYFCKCAHGYDGNPYVQSDGECT

Gene3D: G3DSA:2.10.25.10
290-365 no description

SKHSECTNSTNGPGYFCKCAHGYDGNPYVQSDGECTNINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCD

superfamily: SSF57196
325-382 EGF/Laminin

TNINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCDPLIPMAAVALLTTFAAV

PatternScan: PS01187
IPR018097
326-353 EGF_CA
EGF-like calcium-binding, conserved site

NINECQDPKSHNCSSGSKCIDTDGGYYC

ProfileScan: PS50026
IPR000742
326-365 EGF_3
Epidermal growth factor-like, type 3

NINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCD

HMMSmart: SM00179
IPR001881
326-365 Calcium-binding EGF-like domain
EGF-like calcium-binding

NINECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCD

HMMPfam: PF07645
IPR013091
327-356 EGF_CA
EGF calcium-binding

INECQDPKSHNCSSGSKCIDTDGGYYCQCN

HMMSmart: SM00181
IPR006210
329-365 Epidermal growth factor-like domain.
Epidermal growth factor-like

ECQDPKSHNCSSGSKCIDTDGGYYCQCNFFRRGQQCD

PatternScan: PS00010
IPR000152
344-355 ASX_HYDROXYL
EGF-type aspartate/asparagine hydroxylation site

CIDTDGGYYCQC

PatternScan: PS00022
IPR013032
353-364 EGF_1
EGF-like region, conserved site

CQCNFFRRGQQC

Seg: seg
371-384 seg

AAVALLTTFAAVVL

Seg: seg
396-407 seg

NNRKRFNRNGGK

superfamily: SSF56112
IPR011009
401-730 Protein kinase-like (PK-like)
Protein kinase-like domain

FNRNGGKLLNAQGITTYTKRELKKITNGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEEL

Gene3D: G3DSA:3.30.200.20
411-515 no description

AQGITTYTKRELKKITNGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCL

HMMSmart: SM00219
IPR020635
425-730 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ITNGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEEL

ProfileScan: PS50011
IPR000719
427-742 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEELKRVKVLLLGTHI

HMMSmart: SM00220
IPR002290
427-736 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NGYSKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEELKRVKVL

HMMPfam: PF07714
IPR001245
430-730 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SKRLGGGHFGNVYEGTIVDGRKVAVKCPLRTRVSSHRCHWKNLIRPRRVPLPQQRVEEDGSFMNEIRFQFEVSRHKNLVQLLGCCLETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEEL

PatternScan: PS00107
IPR017441
433-455 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGGGHFGNVYEGTIVDGRKVAVK

Seg: seg
474-485 seg

RPRRVPLPQQRV

Gene3D: G3DSA:1.10.510.10
516-729 no description

ETDIPILVFEFVANGSLEDILHSAKKPCTLSLPERLDIAIGSAEAIAYMHSLDNQKRVHGDIKPSNILLDDDLNPKVSDFGSSKLLAIHSYYVRAVAADIGYMDPLYMKTEHFTLECDVYSFGVVLLELITRRRASWYEQDHQGNKILPIEFVKCFKDHGSGCAMYDSRLDFSAGEDAQSRCNKRCLDMIGMLAVRCLKEDKRERPTMAEVVEE

Seg: seg
725-738 seg

EVVEELKRVKVLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox