PRGDB00064305 (Zm.83374)

From PRG Wiki
Jump to: navigation, search
Zm.83374
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 54653355 (BT018574)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone EL01N0443E08.d mRNA sequence

DNA Sequence

GCACGAGGCTACCCTAAACCCCACTAGGAACACTTCTGGATGGCTATTCCCTTTGTTTCCCATATTTTTGGTCACTGGTTATCTGTTGAGCTTGATATCTGCAAGCAAGTCATGCAGGCAGTTTATGATTCAACTTATTGAGCCATTCACGCACAACAAGAAAACGGTGGACATTAGAGGCAGGTCGGAGGGAACTCCCaaaaaaagaaaaaCACGGAAGAAGGATGGACTTGTCAATAGCTCTGAGACCTTGACAGCATCTGACAAGGAGTGCAGTGATACTGGTGGGTCAACTGAGGCACCAATGAAAAATTCTGCGCTAACAGATGCCCTTGGTGGTCGTCAGATTGGTAAGGTATATGTCTCCAATAAAGAAATTGGCAGAGGGAGCAATGGCACAATTGTTTTTGAAGGATCTTATGATGGTCGTCAAGTTGCCGTGAAACGTCTGCTGCGTTCCCACAATGACATAGCCGAAAAGGAGACTCGAAATCTTATTATATCGGATCATGATCCTAATATTGTTAGACTCTACGGTTGTGACCATGACAGTGATTTTGTTTATATCTCCCTTGAGAGGTGCCACTGCAGCTTGGCTGACCTAATCCAAAAACAGTCATATTTGTCTTCTGGAGAGTCTATTTCTAACAATGAGGTCAGTATGAGCATCAACTCAAAGATTTCAAATGTTAAGGGAATAGACGTGGAGTTGTGGACGCAGGATGGGCTTCCTTCAGCACAACTCCTGAAGCTGATGAGAGATGTGGTTGCTGGCCTTGTGCATTTGCATAACTTGGGAATTATTCATCGTGATTTGAAGCCTCAGAATGTCTTAATAAGCGCAGAAGGACCTATTAGAGCAAAGCTTTCTGATATGGGTATCAGTAAGCACCTGCAAGATGACATGACTTCTGTTAGCCATCATGGTACAGGAATTGGAAGCTCTGGCTGGCAAGCACCCGAACAGCTTCGTCATGGTCGTCAAACTCGTGCAATGGATCTTTTTAGTTTGGGCTGCCTTATTTTCTATTGTATCACTAAAGGCAAGCATCCGTTTGGTGAATACTATGAACGGGATACAAACATTGTAAACAATCGCTTTGATCTCTTTGTGGTGGACTACATACCAGAAGCAGTACATCTTATATCTCAACTGTTACAACCAAACCCAGAGACAAGACCAACGGCAGTATACGTCATGCATCATCCTCTCTTCTGGAGCCCTGAATTGCGCCTTTCGTTTCTAAGGGATACCAGTGACAGAATTGAGAAAACCAGTGAAACGGACCTCATAAACGCACTGGAAAGCATAGGACCAGTGGCGTTTGGTGGGAAATGGGGAGAGAAACTGGATGCTGCTTTAGTTACAGACATGGGTCGTTATAGAAAATATAACTTTGAGTCTACTCGTGATCTTCTGAGGTATATCAGAAATAAATCGGGTCATTACAGAGAACTTTCAAATGATCTCAAGGGCATACTTGGGTCATTGCCAGAGGGATTTGATCACTATTTTGCTAGCCGATTTCCAAAGTTGCTAATTGAGGTGTACAAGGTCTTGTGGGTGCACTGCAAGGACGAAGAAGCTTTCAGTAAACATTTCAATGGAAGCTCCTTATAGCTGGAGAGGATCGCCTTTTCCTCCTGTAAACACTACCCCTGATGTAGAAGTTGTATGCACATTTGATATGTACCCCATATCCCCCGTTTTATAGAATAAAGAGAGCTCAGTCTGTaaaaaaaaaaaaaaaaaaaaaaaaCCTCGAGGGGGGGCC


Protein sequences

Name Description Sequence
Zm.83374 translated coding region predicted by ESTScan from UniGene Zm.83374

XHEATLNPTRNTSGWLFPLFPIFLVTGYLLSLISASKSCRQFMIQLIEPFTHNKKTVDIRGRSEGTPKKRKTRKKDGLVNSSETLTASDKECSDTGGSTEAPMKNSALTDALGGRQIGKVYVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLFWSPELRLSFLRDTSDRIEKTSETDLINALESIGPVAFGGKWGEKLDAALVTDMGRYRKYNFESTRDLLRYIRNKSGHYRELSNDLKGILGSLPEGFDHYFASRFPKLLIEVYKVLWVHCKDEEAFSKHFNGSSLXLERIAFSSCKHYP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR13954:SF4
15-543 IRE1P-RELATED,IRE1P-RELATED

WLFPLFPIFLVTGYLLSLISASKSCRQFMIQLIEPFTHNKKTVDIRGRSEGTPKKRKTRKKDGLVNSSETLTASDKECSDTGGSTEAPMKNSALTDALGGRQIGKVYVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLFWSPELRLSFLRDTSDRIEKTSETDLINALESIGPVAFGGKWGEKLDAALVTDMGRYRKYNFESTRDLLRYIRNKSGHYRELSNDLKGILGSLPEGFDHYFASRFPKLLIEVYKVLWVHCKDEEAFSKHFNGSSLXLE

HMMPanther: PTHR13954
15-543 FAMILY NOT NAMED,IRE1-RELATED

WLFPLFPIFLVTGYLLSLISASKSCRQFMIQLIEPFTHNKKTVDIRGRSEGTPKKRKTRKKDGLVNSSETLTASDKECSDTGGSTEAPMKNSALTDALGGRQIGKVYVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLFWSPELRLSFLRDTSDRIEKTSETDLINALESIGPVAFGGKWGEKLDAALVTDMGRYRKYNFESTRDLLRYIRNKSGHYRELSNDLKGILGSLPEGFDHYFASRFPKLLIEVYKVLWVHCKDEEAFSKHFNGSSLXLE

superfamily: SSF56112
IPR011009
103-466 Protein kinase-like (PK-like)
Protein kinase-like domain

MKNSALTDALGGRQIGKVYVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLFWSPELRLSFLRDTSDRIEKTSETDLINALESIGPVAFGGKWGEKLDAALVTDMGRYRKYN

Gene3D: G3DSA:3.30.200.20
120-208 no description

VYVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSY

ProfileScan: PS50011
IPR000719
121-406 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLF

HMMSmart: SM00219
IPR020635
121-406 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLF

HMMSmart: SM00220
IPR002290
121-406 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YVSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLF

HMMPfam: PF00069
IPR017442
122-406 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VSNKEIGRGSNGTIVFEGSYDGRQVAVKRLLRSHNDIAEKETRNLIISDHDPNIVRLYGCDHDSDFVYISLERCHCSLADLIQKQSYLSSGESISNNEVSMSINSKISNVKGIDVELWTQDGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLF

Gene3D: G3DSA:1.10.510.10
242-426 no description

DGLPSAQLLKLMRDVVAGLVHLHNLGIIHRDLKPQNVLISAEGPIRAKLSDMGISKHLQDDMTSVSHHGTGIGSSGWQAPEQLRHGRQTRAMDLFSLGCLIFYCITKGKHPFGEYYERDTNIVNNRFDLFVVDYIPEAVHLISQLLQPNPETRPTAVYVMHHPLFWSPELRLSFLRDTSDRIEKT

PatternScan: PS00108
IPR008271
268-280 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPQNVLI

ProfileScan: PS51392
IPR010513
409-537 KEN
KEN domain, ribonuclease activator

PELRLSFLRDTSDRIEKTSETDLINALESIGPVAFGGKWGEKLDAALVTDMGRYRKYNFESTRDLLRYIRNKSGHYRELSNDLKGILGSLPEGFDHYFASRFPKLLIEVYKVLWVHCKDEEAFSKHFNG

HMMPfam: PF06479
IPR010513
412-536 Ribonuc_2-5A
KEN domain, ribonuclease activator

RLSFLRDTSDRIEKTSETDLINALESIGPVAFGGKWGEKLDAALVTDMGRYRKYNFESTRDLLRYIRNKSGHYRELSNDLKGILGSLPEGFDHYFASRFPKLLIEVYKVLWVHCKDEEAFSKHFN

HMMSmart: SM00580
IPR006567
468-522 domain in protein kinases, N-glycanases and
PUG domain

ESTRDLLRYIRNKSGHYRELSNDLKGILGSLPEGFDHYFASRFPKLLIEVYKVLW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox