PRGDB00064322 (Zm.84875)

From PRG Wiki
Jump to: navigation, search
Zm.84875
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195640547 (EU967624)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 304938 CBL-interacting serine

DNA Sequence

GCACATCGATCATTCGCGTGTCTAGGTTTCCTCTCTCACCATAGCGCCCGCTCTGTCGCCCTTCGTTCACCTCTCCTTCCTCTCCTCCCTGCCTGCCAGGGAGAGGGGAAGTCAGAGGCACGGAGTGGCGCAGAGCAGACGCACGTGAACCATTGTAGCTGTCCCTgtcgtcgtcgtcgtcgtcAACGAATCCACACAAGGAAAGGATGGAGAAGAAGCCGACCATCCTCATGAACAGGTACGAGCTCGGGCGCACGCTCGGGCAGGGCACCTTCGCCAAGGTGTACCACGGCCGGAACCTCGCGTCCGGCGAGAGCGTGGCCATCAAGGTCATCGACAAGGAGAAGGTGATGCGCGTCGGCATGATCGACCAGATCAAGCGCGAGATCTCCGTCATGCGCCTCGTCCGCCACCCCAACGTCGTGCAGCTGCACGAGGTGATGGCCAGCAAGAGCAAGATATACTTCGCCATGGAGTACGTCCGGGGCGGCGAGCTCTTCGCCCGCGTCGCCCGCGGCCGGCTCAAGGAGGACGCCGCGAGAAGGTACTTCCACCAGCTCGTCGGCGCCGTCGACTTCTGCCACAGCCGCGGCGTCTACCACCGCGACCTCAAGCCCGAGAACCTCCTCGTCGACGAGCACGGCAACCTCAAGGTCTCCGACTTCGGCCTCAGCGCGCTCAGGGAGTGCCAGAAGCAGGACGGCCTGCTGCACACCACCTGCGGCACCCCCGCGTACGTCGCGCCGGAGATCATCAACAAGAAGGGCTACGACGGGGCCAAGGCCGACATCTGGTCCTGCGGCGTCATCCTCTTCGTGCTCCTCGCCGGCTACCTCCCGTTCCACGACGCCAACCTGGTGGAGATGTACCGCAAGATCAGCAGAGCCGACGTCAAGTACCCGCAGTGGTTCTCCCCTGAGCTCCGGCGGTTGATGCCCAAGCTCCTCGAACCGAACCCAAACAACAGGATCACGATCGAGAAGCTGGTCGAGCACCCCTGGTTCAAGAAGGGGTACAGGCCGGCCGTCATGCTGGCACAGCCGCACGGCTCCAGCAGCCTCAAGGATGTCCAGGTCGCCTTCAGCAACGCCGACCACAAGGACAGCAGCACCAAGGTGGAACAGCCGGCGGACAGCTCCTTGAAGCCGGCGAGCCTGAACGCGTTCGACATCATCTCCCACTCCAGAGGGTTCGACCTGTCAAGCCTGTTCGAGGTGGACCAAGAGCAGAAGGCCAGCAACTCGCGGTTCATGACCCAGAAACCGGCGTCGGCGATAGTGTCAAAGCTGGAGCAGATCGCTGAGACAGAGCGCTTCATGGTGAAGAAACAGGACGGGCTGGTGAAGCTGCAGGGGTCCAAGCAAGGGAGGAAGGGGCAGCTCGCGATCGACGCCGAGATCTTCGAGGTGACACCGGCCTTTCACGTCGTCGAGGTGAAGAAGTCGGCAGGCGACACGCTGGAGTATGAGATGTTCTGCAGCAAGGGCCTAAGACCTTCACTCAGCGACATCTGCTGGAGCAGCCGATCTGAGGAGAACATGGCTCCTTCAGTGGTTCAGCCATCACAATTGGAGCCATCCTCTTAGACCGTCTCCGACAGTTTACTCACCCCTCTTAGTCGATTGTTATTTAAGTGCAGTCTCTTCGGAGATGCAATTACAGTCCATCCTCTCTTTCTTTTCCCCTTTCTCAAAGAGCTAGGACCTTGCTCGACTGAGCATCAGGCTGTAGGGCTCTTTGTGATCATCTTTTGCCAGTTTTCTTCTTGTAGCAGAAGTTGTTGGGCATGGAACTCCTGTTCCTTTCACCAATAGAAGCATAATGATCAGCACTGTGAAACATTTTTTCCTATaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.84875 translated coding region predicted by ESTScan from UniGene Zm.84875

MEKKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGYRPAVMLAQPHGSSSLKDVQVAFSNADHKDSSTKVEQPADSSLKPASLNAFDIISHSRGFDLSSLFEVDQEQKASNSRFMTQKPASAIVSKLEQIAETERFMVKKQDGLVKLQGSKQGRKGQLAIDAEIFEVTPAFHVVEVKKSAGDTLEYEMFCSKGLRPSLSDICWSSRSEENMAPSVVQPSQLEPSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343:SF45
1-275 PTHR24343:SF45,SERINE/THREONINE-PROTEIN KINASE PTK1

MEKKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGYRPAVM

HMMPanther: PTHR24343
1-275 PTHR24343,SERINE/THREONINE KINASE

MEKKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGYRPAVM

superfamily: SSF56112
IPR011009
3-297 Kinase_like
Protein kinase-like domain

KKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGYRPAVMLAQPHGSSSLKDVQVAFSNADH

Gene3D: G3DSA:3.30.200.20
7-108 G3DSA:3.30.200.20

ILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKE

HMMPfam: PF00069
IPR017442
12-266 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWF

ProfileScan: PS50011
IPR000719
12-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWF

HMMSmart: SM00220
IPR002290
12-266 S_TKc
Serine/threonine-protein kinase domain

YELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREISVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWF

PatternScan: PS00107
IPR017441
18-41 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYHGRNLASGESVAIK

Gene3D: G3DSA:1.10.510.10
109-314 G3DSA:1.10.510.10

DAARRYFHQLVGAVDFCHSRGVYHRDLKPENLLVDEHGNLKVSDFGLSALRECQKQDGLLHTTCGTPAYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWFSPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGYRPAVMLAQPHGSSSLKDVQVAFSNADHKDSSTKVEQPADSSLKP

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLV

ProfileScan: PS50816
IPR018451
312-336 NAF
NAF/FISL domain

LKPASLNAFDIISHSRGFDLSSLFE

HMMPfam: PF03822
IPR004041
313-374 NAF
NAF domain

KPASLNAFDIISHSRGFDLSSLFEVDQEQKASNSRFMTQKPASAIVSKLEQIAETERFMVKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox