PRGDB00064341 (Zm.85988)

From PRG Wiki
Jump to: navigation, search
Zm.85988
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194707009 (BT042584)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0345O14 mRNA, complete cds

DNA Sequence

TGGTTTCCGTTCCCAATCCCCTTCTTCCCCGACTCGCCCGGCGCTGAATAAGATTCCCCTGTATTCTGTTCCAGAGATGAGCTGATCGAGCAGCCCGTCGCCAAGCCAACCGGACATGGTGAGCGACGGCGCGCGCGGGCTGCTGGGCGCGTACGAGCTCGGGCGGACGCTCGGGGAGGGCAACTTCGGGAAGGTGAAGCAGGCGCGGCACCGCGGCAGCGGCGGGCAGTTTGCCGTGAAGATCATGGAGCGCGCCAGGGTGCTGTCGCAGCGCGCGGACGAGCAGATATGCCGCGAGATCGCCACGCTCAAGCTGCTCGCGCACCCCAACGTCGTCCGCCTCCACGAGGTGGCTGCCAGCAAGACGAAGATCTACATGGTGCTTGAGCTCGTCAACGGCGGCGAGCTGCTGGACAGGATTGCGGCCAGTGAGGGAAAGCTCCCGGAGCAGGAGGCAAGGAGGCTCTTCCAGCAGCTGGTTGATGGTGTAAGCTACTGCCATGAAAAGGGCGTCTGTCACAGAGACCTCAAGCTGGAGAACGTTCTTGTCGACCGGAAGGGAAACATCAAGATCTCTGATTTCGGGCTCAGCGCTTTACCGCAACATCTCGGGAACGATGGGTTGCTGCACACGACCTGCGGTAGCCCCAACTACATTGCCCCTGAGGTTCTGCAGAACAGAGGGTACGACGGGTCGCTATCGGACATCTGGTCATGCGGGGTGATTCTCTACGTGATGCTCGTAGGGCACCTCCCGTTCGACGACCGGAACATCGTCGTTCTCTACCAGAAGATTTTCAAGGGCGATGCTCAGATCCCGGAGTGGCTCTCTCCCGGCGCACGGAACCTTCTCCGGAGGATCCTTGAGCCCGACCCGGCGGAGCGGATCGCCATGGCAGAGATCAAGGCGCACCCATGGTTCCAGGAGCACTACGTCCCTGTCCTTCCTCCGTacgacgacgacgacgaccacgaTTCAGTGAAGCAAATCGGTGCGGGTAGTAAAACCACTCATCACATCAACGCGTTTCAGTTGATCGGAATGGCGTCGTCCCTAGACCTCTCAGGGTTTTTTGAGGAAGAGGACGTGTCCCAAAGGAAGATCAGGTTCACGTCCGCACAACCGCCTGAGGATTTGTTCGCCGAGATCGAACGCTCTGCGACTGACATGGGCTTCCATGTTCACAGAGGGCATAGTAAGCTTAGGCTGACGCGAAACTGCGACCGGTCGAAGAATTAGAAGAACCCTATgtcgtcgtcgtcgtcgtcgtTTCTAGTCTGCACCGAGGTTTTTGAGCTTAGCCCCTCTTTGTATGTCGTGGAGCTCAACAAGTCCCATGGCGACCCTGCACTGTACAGGCAGCTCTGTCAGAGGATCTGCGGTGACCTAGGTGTGCTCGAGATGGACCAGATCTTTGGGACGAGGCCGCCGGTCGCCGACGATCTCGCGGGCTTGGCCTTGGCGTTGGAGAGACGATCTGCGACGCCTTTGGTTGCGTTGTGACGAAAGGCTGCCCCCGCCGGCCCCCCTGACCGTGATGTTTGTAGCGTCAGATTATTTAGTGACGACGAAGCAGTTCAGCTGCAACGCAGCTCGGAACGGTTGTGTGATCCCTCCCAGAAATAGAGGACAAGGTAAAAGAGTGTAGCCGTACACGTGTAGGATCATGCTCCAATGTAAATAAAGTGGTAGTAGCCACCGATGTAAAACTGAATGTAAAATCTAAGAAATAAATCGTTTATCCAGT


Protein sequences

Name Description Sequence
Zm.85988 translated coding region predicted by ESTScan from UniGene Zm.85988

XGFRSQSPSSPTRPALNKIPLYSVPEMSXSSSPSPSQPDMVSDGARGLLGAYELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWFQEHYVPVLPPYDDDDDHDSVKQIGAGSKTTHHINAFQLIGMASSLDLSGFFEEEDVSQRKIRFTSAQPPEDLFAEIERSATDMGFHVHRGHSKLRLTRNCDRSKNXKNPMSSSSSSFLVCTEVFELSPSLYVVELNKSHGDPALYRQLCQRICGDLGVLEMDQIFGTRPPVADDLAGLALALERRSATPLVAL

Domains

Domain Start-End Description Sequence

Seg: seg
23-43 seg

SVPEMSXSSSPSPSQPDMVSD

superfamily: SSF56112
IPR011009
38-339 Protein kinase-like (PK-like)
Protein kinase-like domain

PDMVSDGARGLLGAYELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWFQEHYVPVLPPYDDDDDHDSVKQIGAGSKTTH

HMMPanther: PTHR24343
48-326 FAMILY NOT NAMED,SERINE/THREONINE KINASE

LLGAYELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWFQEHYVPVLPPYDDDDDHD

HMMPanther: PTHR24343:SF128
48-326 SUBFAMILY NOT NAMED

LLGAYELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWFQEHYVPVLPPYDDDDDHD

Gene3D: G3DSA:3.30.200.20
49-160 no description

LGAYELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQL

HMMPfam: PF00069
IPR017442
52-308 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWF

ProfileScan: PS50011
IPR000719
52-308 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWF

HMMSmart: SM00219
IPR020635
52-308 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWF

HMMSmart: SM00220
IPR002290
52-308 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRTLGEGNFGKVKQARHRGSGGQFAVKIMERARVLSQRADEQICREIATLKLLAHPNVVRLHEVAASKTKIYMVLELVNGGELLDRIAASEGKLPEQEARRLFQQLVDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWF

PatternScan: PS00107
IPR017441
58-81 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGNFGKVKQARHRGSGGQFAVK

Gene3D: G3DSA:1.10.510.10
161-311 no description

VDGVSYCHEKGVCHRDLKLENVLVDRKGNIKISDFGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGHLPFDDRNIVVLYQKIFKGDAQIPEWLSPGARNLLRRILEPDPAERIAMAEIKAHPWFQEH

PatternScan: PS00108
IPR008271
172-184 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDLKLENVLV

Seg: seg
320-326 seg

DDDDDHD

ProfileScan: PS50816
IPR018451
336-360 NAF
NAF/FISL domain

KTTHHINAFQLIGMASSLDLSGFFE

HMMPfam: PF03822
IPR004041
340-396 NAF
NAF domain

HINAFQLIGMASSLDLSGFFEEEDVSQRKIRFTSAQPPEDLFAEIERSATDMGFHVH

Seg: seg
419-424 seg

SSSSSS

Seg: seg
480-490 seg

ADDLAGLALAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox