PRGDB00064361 (Zm.93932)

From PRG Wiki
Jump to: navigation, search
Zm.93932
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614161 (EU956793)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1574230 CIPK-like protein 1 mRNA, complete cds

DNA Sequence

ACCCCCGTCGAGCACACAACACACCCTCCTCGTCCTCCAATCCAATCAACCTGGTAGACTCGCTTCGCTTCTCCCCCAGCCGTCGGACGGAGCTCCTCGCAGTCGCAGCAGCCGCCGATCAGCCTGCGCTCGGGCTCAGCGCTGGAAGGTGTTGGAAGAGAATAGCCTGAAGGTTCACAGTAACCTTCATCTGTCGGAAGATGTATCGGGCTAAGAGGGCTGCATTGTCACCGAAGGTGAAGCGCCGCGTCGGCAAGTACGAGCTCGGGCGCACCATTGGGGAAGGGACCTTCGCCAAGGTCCGGTTTGCTAAGAACACTGAAAACGGGGAACCTGTTGCTATCAAAATCCTTGACAAGGAGAAGGTTAAGAGGCACAGATTGGTTGAGCAGATTAAGCGTGAAATTTGTATCATGAAATTAGTAAGGCACCCTAATGTTGTTCGACTGTTTGAGGTGATGGGAAGTAAAGCAAGAATTTTCATCGTTCTGGAATATGTTACCGGCGGAGAGCTTTTCGAAATCATTGCTACTAATGGAAGGTTGAAGGAAGACGAAGCACGTAAATACTTCCAGCAACTGATTAATGCTGTTGATTACTGCCACAGTAGGGGAGTGTATCACAGAGACTTGAAGCTCGAGAATTTGCTGCTTGATGCTGCAGGAAATCTCAAAGTTTCTGACTTTGGTTTAAGTGCTTTAACCGAGCAAGTGAAGGCTGATGGTCTGCTTCATACAACATGTGGAACCCCCAATTATGTTGCCCCTGAGGTGATCGAGGATGGAGGCTATGATGGTGCAACTGCAGATATTTGGTCTTGCGGAGTAATCCTCTTTGTTCTTCTTGCTGGATATTTACCTTTCGAGGATGACAACATCATCGCCCTATACAAGAAGATTTCAGAAGCTCAGTTTAGCTGCCCCTCTTGGTTTTCAGCTGGGGCCAAGAACATGATTACCAGAATTCTTGATCCCAATCCTACAACTAGAATCACGATTTCTCAGATACTGGAGCATCCTTGGTTCAAAAAGGGGTACAAGCCTCCTGTTTTTGACGAGAAATATCAAACTAGCTTGGATGACGTGGATGCTGCTTTTGGAGATTCAGAAGACCGGCATGTGAAAGAGGAAACTGAAGATCAGCCAACCTCAATGAATGCATTCGAACTGATTTCTCTAAACCAGGCACTGAATCTGGAGAATTTGTTTGAAGCAAAGGAGGAGTATAAAAGAGAGACAAGATTCACCTCACAGTGCCCCCCGAAAGAGATAATCACAAAGATCGAAGAAGCTGCAAAGCCGCTTGGCTTTGATGTTCAGAAGAAAAAATACAAGATGCGGATGGAGAACCCGAAAGCAGGTAGAAAGGGCAATCTGAATGTTGCAACTGAGGTTTTCCAAATAGCCCCATCCCTGCATGTAGTCGAGCTCAAGAAGGCGAAGGGGGACACTCTGGAGTTCCAAAAGTTCTACAGAAGCCTGTCGACCCAGCTGAAGGATGTTGTGTGGAAGTGCGACGGCGAGGTGGACGGCAACAGCGCGGCAGCATGAAAGTGCCCTTTGAACTTTCCACTGGACGGCGCCGGTTTTCCTTTGTACATAGCTTCTCTTTCGGATGATCCCGTGTCCATTGCAGAGTCGGTTTTGCAAGCAAGTTCTTTGGTTTATTTGTAGTAAGCCCGGTGAAACAACCGCCCTGGAGGCTGTTGTGGATGAGCTTACTGGCGTGTTTAGTTCGTTTCATGGTCGGGAGGTTGGATGGAATGGAAACCACAATCAAGGCTGTAGTAGTGTGTGTAGTAACGAAGTAGATACATGCATCAGATGGTGTAAGGGAGTACCAGCTGTTAGTTCATGGTTTCAAGCTTAGCCCCCCTTCAATTTGTTCGATGATGTATTACTTCACAATAAACATTATTACTTAGATGTATGAGGTGAGCACACTTGGTCaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.93932 translated coding region predicted by ESTScan from UniGene Zm.93932

XPRRAHNTPSSSSNPINLVDSLRFSPSRRTELLAVAAAADQPALGLSAGRCWKRIAXRFTVTFICRKMYRAKRAALSPKVKRRVGKYELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWFKKGYKPPVFDEKYQTSLDDVDAAFGDSEDRHVKEETEDQPTSMNAFELISLNQALNLENLFEAKEEYKRETRFTSQCPPKEIITKIEEAAKPLGFDVQKKKYKMRMENPKAGRKGNLNVATEVFQIAPSLHVVELKKAKGDTLEFQKFYRSLSTQLKDVVWKCDGEVDGNSAAA

Domains

Domain Start-End Description Sequence

Seg: seg
32-48 seg

LLAVAAAADQPALGLSA

superfamily: SSF56112
IPR011009
73-373 Protein kinase-like (PK-like)
Protein kinase-like domain

RAALSPKVKRRVGKYELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWFKKGYKPPVFDEKYQTSLDDVDAAFGDSEDRH

Gene3D: G3DSA:3.30.200.20
74-185 no description

AALSPKVKRRVGKYELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKED

HMMPanther: PTHR24345
79-514 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK

KVKRRVGKYELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWFKKGYKPPVFDEKYQTSLDDVDAAFGDSEDRHVKEETEDQPTSMNAFELISLNQALNLENLFEAKEEYKRETRFTSQCPPKEIITKIEEAAKPLGFDVQKKKYKMRMENPKAGRKGNLNVATEVFQIAPSLHVVELKKAKGDTLEFQKFYRSLSTQLKDVVWKCDGEVDGNSA

HMMPanther: PTHR24345:SF45
79-514 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK1

KVKRRVGKYELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWFKKGYKPPVFDEKYQTSLDDVDAAFGDSEDRHVKEETEDQPTSMNAFELISLNQALNLENLFEAKEEYKRETRFTSQCPPKEIITKIEEAAKPLGFDVQKKKYKMRMENPKAGRKGNLNVATEVFQIAPSLHVVELKKAKGDTLEFQKFYRSLSTQLKDVVWKCDGEVDGNSA

HMMPfam: PF00069
IPR017442
87-342 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWF

ProfileScan: PS50011
IPR000719
87-342 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWF

HMMSmart: SM00219
IPR020635
87-342 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWF

HMMSmart: SM00220
IPR002290
87-342 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRTIGEGTFAKVRFAKNTENGEPVAIKILDKEKVKRHRLVEQIKREICIMKLVRHPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEDEARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWF

PatternScan: PS00107
IPR017441
93-116 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTFAKVRFAKNTENGEPVAIK

Gene3D: G3DSA:1.10.510.10
186-349 no description

EARKYFQQLINAVDYCHSRGVYHRDLKLENLLLDAAGNLKVSDFGLSALTEQVKADGLLHTTCGTPNYVAPEVIEDGGYDGATADIWSCGVILFVLLAGYLPFEDDNIIALYKKISEAQFSCPSWFSAGAKNMITRILDPNPTTRITISQILEHPWFKKGYKPP

PatternScan: PS00108
IPR008271
206-218 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKLENLLL

ProfileScan: PS50816
IPR018451
380-404 NAF
NAF/FISL domain

DQPTSMNAFELISLNQALNLENLFE

HMMPfam: PF03822
IPR004041
381-441 NAF
NAF domain

QPTSMNAFELISLNQALNLENLFEAKEEYKRETRFTSQCPPKEIITKIEEAAKPLGFDVQK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox