PRGDB00064363 (Zm.94165)

From PRG Wiki
Jump to: navigation, search
Zm.94165
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195616653 (EU958039)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1668278 protein kinase APK1B mRNA, complete cds

DNA Sequence

ACTCGATTCACTCCACGCGCCAAACTTAGCATccctctcctcccgcctcctctccaccggtatcggtgtcctcctccggtcccccctccctcTGGGAAGGCCCTTGGATCTCTCGATCTCCAAGGCCTGCCTTCCATTGCCATAGCCATCGACCGTCGTTCTCGCCTCGTGGTGGTCTCGTGCCCCTCTCCGGTCGCCTGAGCAACCCACCACTAGTCTGGTCACGCTCCCCTGCTCCGCACCGGACGGGCGGGTTTCATTTGGTGCGCGTGCGGCGAGCTCGGGCATGGCGTTCCACGAAGTGGAGACGCCGCGTCGATGCTGAGACGCCGGGGCATGGTCGGCGCGCAGTGACGGCGGCCGGCGGCTCGGTCCGTGCGTGCGTGCCCAGCATTCTTGCCCCTGTCGAGTCATCGgctcgtcgctcgctcgcgcccacgccgctcgccccgcgtccacagggtcgccgcCACGGGGAGGCGCAGAGGGAAAAGGAAGATGAGCTGCTTTCCGTGCTTCGGCGGCGGAAAGGGCAACAACGACGACGCCGACGCGGAGAGCCCGGGCGACGCGGCCCCGGCGTCTAACATGACGCCGCCCGCGATGGTGcaggcgcccgccgcgtacttcccagctcccgccgccgctccaacggccgcggcgccgcccAAGCCCGGTGGCGGGAACCAGGCGCACGAGGCTTCCGCCGATGACTCGGCGCTGCGGCTCGCCATCACGGGGCAGGCGTTCGCGTTCCGCGAGCTCGCCGCCGCCACAGACCACTTCACGCCGTACAACCTCGTCGGTGAAGGCGGCTTCTTCCGGGTCTACAAGGGCCGGCTAGAGAAGAGCGGGCAGACCGTGGCCATCAAGCAGCTGGACAAGCATGGGTTCCAGGACAACAAGGCGTTCTTGACCGGGGTCGCCAAGCTCAGCCAGCTCCACCACGAGAACCTCGTCGACATCATTGGCTACTGCGCTGACGGAGACCAGCGGCTGCTGGTGTACGAGTCCGTGCCCGCCGGCACCTTAGAAGACCACCTGTTCGATCTGCCGGCGGACAAGAAGCCGATGGACTGGTGCACGAGGATGAAGGTGGCGCACGGCGCCGCGCAGGGGCTGGAGTACCTGCACGAGACAGCGAACCCGCCGGTGGTGTACGGGGAATTCAAGGCCTCCCACATACTTCTCGACGAGAAGCTCACGCCCAAGCTCTCCGACTTCGGGCTCGCGCAGCTCGGCCAGGCCGGGGGCAGCATGCCGGTGGTGGCGTCGCCCATGATGGGCTCCTTCGGCTGCTGCGCGCCGGAGTACGATCGCACCGGGCAGGCCACCATGAAGTCCGACGCGTACAGCTTCGGGGTGGTGCTGGTGCAGCTCATCTCCGGGAGGAGGGCCGTCGATACCAGCAAGCCGGTGGACGAGCAGAACGTTGTCACCTGGGCCATGCCGATGTTCAAGGACCAGAAGAGATACCATGAGCTGGTTGATCCACTCATAAAGAAGGAATACCCTGCCAAAGCGTTGAACCAGGTGGTCGCCATGGCTGCGATGTGCTTGCAGGAAGAGGACTCCGTGCGACCGCTGATGGCCGACGTCGTCATGACGCTAGGCTTCCTCACGGCGATGCCGCCTGACCCACCGGCCCCTGCCGCTCCACCACCTGCCGCCGCCCCGGAGTCGAAGGAAGACAAAGAATCGGACCATTCAGACTCCTCGTCATCTTCTTCTTCAGACGACGACGAAGATAACGAGGAGGAGGAAACCGAGGAGCAATGATAAGGGCGGGTGTGTTCAACTTCGAAGGCTTCAAACGTGGAAGGGACACACAGATGAAGTGGCTTCGTGCCGTGTACACGGAGCTCAATATGTGGGACCTTGGAGCCACTTGGACTTGGTGGTTGTGGGCTGTGGCAGTTAAATTGGGGTGTTCACAAGTGAGTAATCtttttttttGTGATGACGCCAAGCATGTAAAAATGTGAGCTATGACATACTGATGGGTTACACAATTTGCACTTTAATCTGCTTTTCTTATGGCCGaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.94165 translated coding region predicted by ESTScan from UniGene Zm.94165

TRFTPRAKLSIPLLPPPLHRYRCPPPVPPPSGKALGSLDLQGLPSIAIAIXPSFSPRGGLVPLSGRLSNPPLVWSRSPAPHRTGGFHLVRVRRARAWRSTKWRRRVDAETPGHGRRAVTAAGGSVRACVPSILAPVESSARRSLAPTPLAPRPQGRRHGEAQREKEDELLSVFGGGKGNNDDADAESPGDAAPASNMTPPAMVQAPAAYFPAPAAAPTAAAPPKPGGGNQAHEASADDSALRLAITGQAFAFRELAAATDHFTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFLTAMPPDPPAPAAPPPAAAPESKEDKESDHSDSSSSSSSDDDEDNEEEETEEQXXGRVCSTSKASNVEGTHRXSGFVPCTRSSICGTLEPLGLGGCGLWQLNWGVHK

Domains

Domain Start-End Description Sequence

Seg: seg
12-30 seg

PLLPPPLHRYRCPPPVPPP

Seg: seg
174-185 seg

GGGKGNNDDADA

Seg: seg
205-225 seg

APAAYFPAPAAAPTAAAPPKP

superfamily: SSF56112
IPR011009
234-560 Protein kinase-like (PK-like)
Protein kinase-like domain

ASADDSALRLAITGQAFAFRELAAATDHFTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFLTAMPPDPPAPAAPPPAAAPE

HMMPanther: PTHR24420
245-613 FAMILY NOT NAMED,FAMILY NOT NAMED

ITGQAFAFRELAAATDHFTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFLTAMPPDPPAPAAPPPAAAPESKEDKESDHSDSSSSSSSDDDEDNEEEETEEQXXGRVCSTSKASNVEGTHRXS

HMMPanther: PTHR24420:SF657
245-613 SUBFAMILY NOT NAMED

ITGQAFAFRELAAATDHFTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFLTAMPPDPPAPAAPPPAAAPESKEDKESDHSDSSSSSSSDDDEDNEEEETEEQXXGRVCSTSKASNVEGTHRXS

Gene3D: G3DSA:3.30.200.20
248-337 no description

QAFAFRELAAATDHFTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYE

ProfileScan: PS50011
IPR000719
262-540 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFL

HMMSmart: SM00220
IPR002290
262-540 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFL

HMMSmart: SM00219
IPR020635
262-537 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FTPYNLVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTL

HMMPfam: PF07714
IPR001245
267-536 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LVGEGGFFRVYKGRLEKSGQTVAIKQLDKHGFQDNKAFLTGVAKLSQLHHENLVDIIGYCADGDQRLLVYESVPAGTLEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMT

Gene3D: G3DSA:1.10.510.10
344-577 no description

LEDHLFDLPADKKPMDWCTRMKVAHGAAQGLEYLHETANPPVVYGEFKASHILLDEKLTPKLSDFGLAQLGQAGGSMPVVASPMMGSFGCCAPEYDRTGQATMKSDAYSFGVVLVQLISGRRAVDTSKPVDEQNVVTWAMPMFKDQKRYHELVDPLIKKEYPAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFLTAMPPDPPAPAAPPPAAAPESKEDKESDHSDSSSSSS

Seg: seg
542-559 seg

AMPPDPPAPAAPPPAAAP

Seg: seg
560-591 seg

ESKEDKESDHSDSSSSSSSDDDEDNEEEETEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox