PRGDB00064364 (Zm.94224)

From PRG Wiki
Jump to: navigation, search
Zm.94224
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21206623 (AY103545)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays PCO153236 mRNA sequence

DNA Sequence

TTGACTGCAGGCCTCGGCACGGTAGGCACAAATCATTTTGGCCGCTGCGTCGCGTTGGGAGCAGTATTCTACTGTGCCTGCGTCCCGACAAGCGAAAAGAAGAGACGGGGGAGGGTGGGAGAACGGATACCGAaaggggtaggagagtgagcagccagagaacagggaggtagagaggaggaggaggtagaAGGCGAAAGAAGGGGAACCAAATCTTGGACGGGAACACATAGATTTCTTTGGTGGAGGAAGGAGGAGGGCAACAAGAGGAGGTTACAGGTAGCCCAATAGATCTACTGCTGTTGAGGGAGTTGATGCAAAGCTGAGTTGCTGCGCGTTGGCTTTCTTTAGAGATGGCTTCAGCTGGTGTTGCCCCTTCTGGGTACAAGAACAGCAGCAGCACCAGCATTGGTGCCGAAAAGTTGCAAGATCACATGAACGAGCTAAAGATTAGAGATGATAAGGAAGTTGAAGCAACCATAATTAATGGGAAAGGGACTGAAACTGGGCACATAATTGTCACCACTACTGGTGGCAAGAATGGTCAACCAAAACAGACAGTGAGCTACATGGCTGAGCGCATTGTAGGTCAAGGTTCTTTTGGGATCGTCTTCCAGGCCAAGTGTTTGGAAACGGGTGAGACTGTTGCCATAAAGAAGGTTCTTCAAGACAAGCGTTACAAGAACCGCGAACTGCAGACCATGCGCCTTCTTGACCACCCTAATGTTGTTGCTTTGAAGCATTGCTTCTTTTCAACTACTGAGAAGGATGAGCTTTATCTGAACTTGGTCCTTGAGTATGTTCCGGAGACAGTTCATCGAGTTGTGAAACATCACAACAAGATGCACCAACGCATGCCACTTATTTATGTGAAGCTTTATATGTACCAGATATGTAGAGCATTGGCTTACATTCATGGTACTATCGGTGTCTGCCACAGAGATATTAAGCCACAAAATCTTCTGGTGAACCCACACACCCACCAGCTTAAAATATGTGACTTTGGTAGTGCAAAAGTTCTGGTCAAGGGGGAACCAAACATATCATACATCTGCTCGCGATACTATAGGGCTCCAGAGCTCATATTTGGTGCCACTGAGTATACCACAGCGATTGACATTTGGTCTGCTGGATGTGTTCTTGCTGAGCTTATGCTAGGGCAGCCTTTGTTTCCGGGTGAAAGTGGTGTGGACCAACTTGTTGAAATCATCAAGGTCCTCGGTACGCCAACAAGGGAAGAAATTAAATGCATGAACCCAAATTACACAGAGTTTAAGTTCCCACAAATCAAAGCACACCCATGGCACAAGGTATTCCACAAAAGGATGCCGCCAGAAGCTGTTGATCTGGTCTCTCGGCTACTCCAGTACTCCCCAAATCTGAGATGCACTGCTATGGAGGCACTTGTTCACCCATTCTTTGATGAGCTTCGAGATCCTAATACTCGCCTTCCAAATGGTCGCTTTTTGCCACCACTATTCAATTTCAAGCCTCACGAACTTAAAGGAGTCCCATCAGACATTGTTGCGAAATTGGTTCCAGAACATGCGAAGAAGCAATGCTCTTATGTTGGATTGTGAAATGACCGCGCCTTGGGACTGGAACCTGAGGTCGCAATCGTGCATTTCCCCTGGGATGTTGGATGATCTTGAGGCATGCGAGCCTGTTGTTGAAGATGCAAGGTTACGTACTTGTACGACAATGTGACCTGTGTAGCTGAGTAGTCTATGTCGCAGTGACATGTAACGGCACCCCCCTTCCTACTAACTGACGCTTACTCGAGATTGCCATAGTTGATCTTGTAATTTGTTATAGAGCAGTATGAATGTATTTATGGTAGCTTGAATCTATGTATGGATTCACTTCGTTTTTCCATGTTTCCTTGTCTCCAGACCCAGATTGCTACCGTATTGTTTCAGAATTCCTAGCTACCTGTTGCCTaaaaaaaaaaaaaaaaaaCCTCGTGC


Protein sequences

Name Description Sequence
Zm.94224 translated coding region predicted by ESTScan from UniGene Zm.94224

XDCRPRHGRHKSFWPLRRVGSSILLCLRPDKRKEETGEGGRTDTERGRRVSSQRTGRXRGGGGRRRKKGNQILDGNTXISLVEEGGGQQEEVTGSPIDLLLLRELMQSXVAARWLSLEMASAGVAPSGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPSDIVAKLVPEHAKKQCSYVGLXNDRALGLEPEVAIVHFPWDVG

Domains

Domain Start-End Description Sequence

Seg: seg
30-69 seg

DKRKEETGEGGRTDTERGRRVSSQRTGRXRGGGGRRRKKG

Seg: seg
82-94 seg

VEEGGGQQEEVTG

HMMPanther: PTHR24057
121-529 FAMILY NOT NAMED,GLYCOGEN SYNTHASE KINASE-3 ALPHA

SAGVAPSGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFFDELRDPNTRLPNGRFLPPLFNFKPHELKGVPSDIVAKLVPEHAKKQCSYVGLXND

Gene3D: G3DSA:3.30.200.20
183-265 no description

QPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVL

superfamily: SSF56112
IPR011009
189-505 Protein kinase-like (PK-like)
Protein kinase-like domain

SYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFFDELRDPNTRLPNGRFLPPLFNFKPHELKGVP

ProfileScan: PS50011
IPR000719
190-474 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFF

HMMSmart: SM00219
IPR020635
190-473 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPF

HMMSmart: SM00220
IPR002290
190-474 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFF

HMMPfam: PF00069
IPR017442
192-474 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

AERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFF

PatternScan: PS00107
IPR017441
196-220 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGQGSFGIVFQAKCLETGETVAIKK

Gene3D: G3DSA:1.10.510.10
266-481 no description

EYVPETVHRVVKHHNKMHQRMPLIYVKLYMYQICRALAYIHGTIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFFDELRDPN

PatternScan: PS00108
IPR008271
311-323 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDIKPQNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox