PRGDB00064366 (Zm.94557)

From PRG Wiki
Jump to: navigation, search
Zm.94557
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194688183 (BT033171)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0166O10 mRNA, complete cds

DNA Sequence

GTCAGGTTTACCTTGGATTTAACAGTGAAAATGGGCAGTTTTGTGCGATTAAGGAGGTTCAAGTTATTATGGATGATCCACATTCGAAGGAACGACTCAAACAATTAAACCAGGAAATAGATATGCTTAGACAACTCTCCCACCCAAACATAGTGCAGTACCATGGAAGTGAGCTGAGTGATGAATCACTTTCCATTTGTCTTGAGTATGTTTCGGGGGGTTCAATCCACAAATTATTAAGAGAATATGGCTCTTTTAAGGAACCTGTGATTCGTAATTACACTGGGCAAATTCTTGCTGGCCTTGCCTACTTACATGGGCGGAACACTGTCCACAGAGATATCAAAGGAGCAAACATACTCGTGGGTCCTAATGGTGAAGTCAAGCTGGCTGACTTTGGCATGGCTAAGCATATATCATCTTTTGCTGAAATACGTTCTTTCAAAGGAAGTCCTTACTGGATGGCTCCTGAGGTTATAATGAACTGTAAAGGCTACAGTTTATCAGTGGACATATGGAGTCTGGGCTGTACCATTATTGAAATGGCGACGGCAAGACCTCCTTGGCACCAATACGAGGGGGTAGCAGCAATATTTAAGATCGCAAACAGTAAAGATATACCTGAAATCCCAGACAGTTTCTCAGAGGAAGGGAAAAGTTTCTTGCAGCTTTGCTTGAAACGTAACCCTGCATCTCGTGCTTCTGCAGTCCAGCTGATGGATCATCCTTTTGTTCAGGATCACCCTGCAGTGAGAGCTGCAAAATCCAGTGTATTGAGAAACACACCATCTTCTCCAGCAGATGGCAGACACACAATGTCCAACAGGGAGTTGCCATCTCGGAAAATTATAACTCCTCTGAAGGATATTGGACTGGGCATGAGAGATTTTACTGGATTTTCCACTACTGTTCCTTCACCACACAGTCCTATTCCTGGAAGAGCAAACATGTCTACGCCAGTTTCACCATGCTCAAGCCCGCTGCGGCAGTTTAAGCAATCCAATGTGAGGGGCATGCGTTCTCCACCTCATCCAATGCTCTCCCCTGGTCTTGGCAACACAGTAAGTTACACCCAAAATCAGACAAGACGCAATCCAGCTCCTGCCATTTCAGATCCTTGGATGGATGTTGGCCAGATGAAACTCCAAAGCCCCAATATTTCCCCCAGAAGGTTCTGAGAACGATTTAAATATAAAAAAAGAGAATCATGGGCGCAATATATCCATGACAAGTTAGTTATTAAGAGATGTTCAGTAAGGAACTTGTTTGTGTAGTTACTACAATACGACACTCACCAGAGATTCAGTACAGCGAAATGGGGCTCTTGAGAATTTGTAACAGGAAGTTCTGTATATCCTTAGGTTTTAAGGTTTGTTGTCGCCCTTGCTATATGTAGTTATACGTGTACACGTCCTGATGTAAAGGTTCACAAAAAATCTTACAGATGACCACGGGATGTAAATTCGAAAGTTTGTGC


Protein sequences

Name Description Sequence
Zm.94557 translated coding region predicted by ESTScan from UniGene Zm.94557

XQVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFVQDHPAVRAAKSSVLRNTPSSPADGRHTMSNRELPSRKIITPLKDIGLGMRDFTGFSTTVPSPHSPIPGRANMSTPVSPCSSPLRQFKQSNVRGMRSPPHPMLSPGLGNTVSYTQNQTRRNPAPAISDPWMDVGQMKLQSPNISPRRF

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-245 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XQVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFV

HMMPfam: PF00069
IPR017442
2-245 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFV

superfamily: SSF56112
IPR011009
2-305 Protein kinase-like (PK-like)
Protein kinase-like domain

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFVQDHPAVRAAKSSVLRNTPSSPADGRHTMSNRELPSRKIITPLKDIGLGMRDFTGFSTTVP

Gene3D: G3DSA:3.30.200.20
2-87 no description

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFK

HMMPanther: PTHR24361:SF64
2-345 SUBFAMILY NOT NAMED

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFVQDHPAVRAAKSSVLRNTPSSPADGRHTMSNRELPSRKIITPLKDIGLGMRDFTGFSTTVPSPHSPIPGRANMSTPVSPCSSPLRQFKQSNVRGMRSPPHP

HMMPanther: PTHR24361
2-345 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFVQDHPAVRAAKSSVLRNTPSSPADGRHTMSNRELPSRKIITPLKDIGLGMRDFTGFSTTVPSPHSPIPGRANMSTPVSPCSSPLRQFKQSNVRGMRSPPHP

HMMSmart: SM00219
IPR020635
2-245 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFV

HMMSmart: SM00220
IPR002290
2-245 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

QVYLGFNSENGQFCAIKEVQVIMDDPHSKERLKQLNQEIDMLRQLSHPNIVQYHGSELSDESLSICLEYVSGGSIHKLLREYGSFKEPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFV

Gene3D: G3DSA:1.10.510.10
88-277 no description

EPVIRNYTGQILAGLAYLHGRNTVHRDIKGANILVGPNGEVKLADFGMAKHISSFAEIRSFKGSPYWMAPEVIMNCKGYSLSVDIWSLGCTIIEMATARPPWHQYEGVAAIFKIANSKDIPEIPDSFSEEGKSFLQLCLKRNPASRASAVQLMDHPFVQDHPAVRAAKSSVLRNTPSSPADGRHTMSNRE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox