PRGDB00064367 (Zm.94693)

From PRG Wiki
Jump to: navigation, search
Zm.94693
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224031290 (BT067824)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0166J20 mRNA, complete cds

DNA Sequence

CAAATCCTCGCCCCTGCCGACACGGGCGCGCCacgcccgagccctaagcccgcacgcgcattcgccgggctcccgctgcgccccgccccgcccTCCGCTCTGTACCGGCGCCAATCGCCGGCGGAGGGTTGCTTACCTTGACTGATATAGGCAATTGAGTATGCTGCTACTTTAATTTGCCCGTGGAAATTCATCAGATGGATTGTCTCAACCTTAGGACATCTTTCCGTGTTCTGCTCTCGATACAGTTGCTGCTATCATCGTTCAGTCCCTTGATTGTAGCGAACTTATCTTCGGAGAAGCAAGCCCTTCTTGACTTTGTCTCTGCAGTCTATCATGGAAACAAGCTCAACTGGGATAAACATACCTCAGTTTGTTCATGGCATGGCGTAAAATGCTCAGAAGATCAGTCACAAGTTTTTGAATTGAGGGTACCGGCTGCTGGTCTTATCGGAGTAATTTCTCCAAACACTCTTGGCAAGCTTTATTCTCTTCAAGTACTGAGCCTGCGGTCTAATCGATTGACCGGAAGTCTTCCAGCTGATGTGGCCTCCCTTCCGTCTTTACGTTCCATATACCTACAGCACAATGAACTTTCAGGAGGGTTGCCTTCTTCCTTCAGTCCTAACCTCAGTGTAATAGATTTCTCCTACAATTCCTTCACAGGAGAAGTACCTGCAAGTTTACAAAACCTCACTCAGTTAACCGTTCTTAATTTGCAAGATAACTCTTTCTCTGGATCCATCCCTGACCTCAAGCTTCACAGTCTGAAACTATTAAATCTGAGCAACAATGAACTGAAAGGCTCAATTCCTCGATCTCTCCAGAAATTTCCAAAGGGTTCATTTTCAAGGAATCCTGGACTGTGTGGGCTACCTCTAGCTGAATGCTCACATCCTTCACCAGCACGCTCACCTGAATCATCTCCATCGCCTCAATCTCCACCTTTGACACATCATGATAAGAAACTAGGCACGGGTTTCATAGTTGCAGTTGCTGTTGGTGGGTTTGCATTGCTGACGCTAATCGTGGTTGTGTGCTTTTCAAAGAGGAAAGGCAAGGACGAGATTGATGTGGAATCCAAAGGAAAGGGTACTGCCACCAGGAGCGAGAAGCCGAAGCAAGAATTCAGTAGCGGCGGCCAAATTGCTGAGAAGAATAAGTTGGTGTTCTTGGAGGGTTGCACCTATAGCTTTGACCTGGAGGATCTACTGAGGGCTTCTGCAGAAGTCCTTGGCAAGGGTAGTTATGGAACTGCTTACAAAGCTGTACTCGAAGATGGTACTGTCGTGGTAGTGAAGAGATTAAAAGATGTTGTGGCAGGGAAAAGAGAGTTTGAGCAGCAGATGGAGCTCATCGAGAGGTTGGGCAAACATGCAAACCTACTCCCACTACGCGCCTACTACTATTCCAAAGACGAGAAGCTCATCGTCTATGATTATATTGACACTGGAAGTGTTTCGGCCATGTTGCATGGTATCCGGGGCGTTACCGCGAAGACACCGTTAGATTGGAACTCCAGAATGAAGATCATCCTTGGAACAGCATATGGAATTGCACATATACATTCAGAAGGGGGCGCGAAGCTCACCCATGGCAATGTCAAGTCAACCAACGTACTCGTAGACCAAGATCACAATCCTTCCGTCTCGGACTATGGCCTCAGCGCTCTGACGAGTGTGCCGGTCAACGCATCTCGCGTCGTGGTCGGCTACCGTGCTCCAGAGATAGTCGAGAACCGCAAGATCACCCAGAAGTCCGACGTCTACAGCTTCGGCGTCCTCCTCATGGAGATGCTCACAGGGAAGGCCCCGCTCCAGACGCAGGGGAACGACGACGTCGTCGACCTGCCGAGATGGGTGCACTCGGTGGTCCGGGAGGAGTGGACGGCCGAGGTGTTTGACGTGGAGCTGATGAAGCACCAGAACATCGAGGAGGAGCTGGTACAGATGCTGCAGATAGCCATGGTGTGCACTGCCAAGTCGCCAGACCGGCGCCCGACGATGGAGGAGGTGATCAGGATGATTGAGGGGCTCCGCCAGTCCACCTCGGAGAGCCGCGCGTCTTCTGATGAGAAATCCAAGGAGTCGAACCCTCCATCGGTGTAAATCCTGCGCAGCTCCCTTCGTCCGCTTGATCGGTTGTTGTTGCCAGTTGCACCTCATTTGATTTGTTAGCTAATTTATTTATGATTG


Protein sequences

Name Description Sequence
Zm.94693 translated coding region predicted by ESTScan from UniGene Zm.94693

QILAPADTGAPRPSPKPARAFAGLPLRPAXALRSVPAPIAGGGLLTLTDIGNXVCCYFNLPVEIHQMDCLNLRTSFRVLLSIQLLLSSFSPLIVANLSSEKQALLDFVSAVYHGNKLNWDKHTSVCSWHGVKCSEDQSQVFELRVPAAGLIGVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNELSGGLPSSFSPNLSVIDFSYNSFTGEVPASLQNLTQLTVLNLQDNSFSGSIPDLKLHSLKLLNLSNNELKGSIPRSLQKFPKGSFSRNPGLCGLPLAECSHPSPARSPESSPSPQSPPLTHHDKKLGTGFIVAVAVGGFALLTLIVVVCFSKRKGKDEIDVESKGKGTATRSEKPKQEFSSGGQIAEKNKLVFLEGCTYSFDLEDLLRASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQSTSESRASSDEKSKESNPPSV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF547
60-681 SUBFAMILY NOT NAMED

LPVEIHQMDCLNLRTSFRVLLSIQLLLSSFSPLIVANLSSEKQALLDFVSAVYHGNKLNWDKHTSVCSWHGVKCSEDQSQVFELRVPAAGLIGVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNELSGGLPSSFSPNLSVIDFSYNSFTGEVPASLQNLTQLTVLNLQDNSFSGSIPDLKLHSLKLLNLSNNELKGSIPRSLQKFPKGSFSRNPGLCGLPLAECSHPSPARSPESSPSPQSPPLTHHDKKLGTGFIVAVAVGGFALLTLIVVVCFSKRKGKDEIDVESKGKGTATRSEKPKQEFSSGGQIAEKNKLVFLEGCTYSFDLEDLLRASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQ

HMMPanther: PTHR24420
60-681 FAMILY NOT NAMED,FAMILY NOT NAMED

LPVEIHQMDCLNLRTSFRVLLSIQLLLSSFSPLIVANLSSEKQALLDFVSAVYHGNKLNWDKHTSVCSWHGVKCSEDQSQVFELRVPAAGLIGVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNELSGGLPSSFSPNLSVIDFSYNSFTGEVPASLQNLTQLTVLNLQDNSFSGSIPDLKLHSLKLLNLSNNELKGSIPRSLQKFPKGSFSRNPGLCGLPLAECSHPSPARSPESSPSPQSPPLTHHDKKLGTGFIVAVAVGGFALLTLIVVVCFSKRKGKDEIDVESKGKGTATRSEKPKQEFSSGGQIAEKNKLVFLEGCTYSFDLEDLLRASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQ

Seg: seg
79-92 seg

LLSIQLLLSSFSPL

superfamily: SSF52058
87-298 L domain-like,LRR

SSFSPLIVANLSSEKQALLDFVSAVYHGNKLNWDKHTSVCSWHGVKCSEDQSQVFELRVPAAGLIGVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNELSGGLPSSFSPNLSVIDFSYNSFTGEVPASLQNLTQLTVLNLQDNSFSGSIPDLKLHSLKLLNLSNNELKGSIPRSLQKFPKGSFSRNPGLCGLPLAECS

HMMPfam: PF08263
IPR013210
98-134 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

SSEKQALLDFVSAVYHGNKLNWDKHTSVCSWHGVKCS

Gene3D: G3DSA:3.80.10.10
119-278 no description

WDKHTSVCSWHGVKCSEDQSQVFELRVPAAGLIGVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNELSGGLPSSFSPNLSVIDFSYNSFTGEVPASLQNLTQLTVLNLQDNSFSGSIPDLKLHSLKLLNLSNNELKGSIPRSLQKF

HMMPfam: PF13855
150-199 LRR_8,Leucine rich repeat

LIGVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNEL

HMMSmart: SM00369
IPR003591
162-185 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYSLQVLSLRSNRLTGSLPADVAS

HMMSmart: SM00369
IPR003591
186-209 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPSLRSIYLQHNELSGGLPSSFSP

HMMPfam: PF12799
209-252 LRR_4,Leucine Rich repeats (2 copies)

PNLSVIDFSYNSFTGEVPASLQNLTQLTVLNLQDNSFSGSIPDL

Seg: seg
229-241 seg

LQNLTQLTVLNLQ

Seg: seg
252-270 seg

LKLHSLKLLNLSNNELKGS

HMMSmart: SM00369
IPR003591
254-277 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHSLKLLNLSNNELKGSIPRSLQK

HMMPfam: PF00560
IPR001611
256-277 LRR_1
Leucine-rich repeat

SLKLLNLSNNELKGSIPRSLQK

Seg: seg
298-316 seg

SHPSPARSPESSPSPQSPP

superfamily: SSF56112
IPR011009
374-684 Protein kinase-like (PK-like)
Protein kinase-like domain

KQEFSSGGQIAEKNKLVFLEGCTYSFDLEDLLRASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQSTS

ProfileScan: PS50011
IPR000719
406-679 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGL

HMMSmart: SM00219
IPR020635
406-676 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMI

HMMSmart: SM00220
IPR002290
406-676 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMI

Gene3D: G3DSA:3.30.200.20
409-482 no description

AEVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYI

HMMPfam: PF00069
IPR017442
410-674 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGKREFEQQMELIERLGKHANLLPLRAYYYSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIR

PatternScan: PS00107
IPR017441
412-443 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSYGTAYKAVLEDGTVVVVKRLKDVVAGK

Seg: seg
430-440 seg

VVVVKRLKDVV

Gene3D: G3DSA:1.10.510.10
500-696 no description

KTPLDWNSRMKIILGTAYGIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSALTSVPVNASRVVVGYRAPEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQSTSESRASSDEKSKE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox