PRGDB00064372 (Zm.95124)

From PRG Wiki
Jump to: navigation, search
Zm.95124
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224033554 (BT068956)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0040L14 mRNA, complete cds

DNA Sequence

TGCCTTCGGTTGCCTTCTCATGTTGATGCAGACACTCAAAGGGCTTTTGTTGAAGAGGTGATGGAACTTGTTGAGTTGAATCCCTTAAGCGGTGCTCTTGTTGGTCTGCCTGGGGTAAATGGTTTATCGACTGAACAACGTAAAAGGTTGACAATCGCTGTGGAACTTGTTGCAAATCCTTCTATTGTGTTCATGGATGAACCCACGTCAGGATTGGATGCTAGATCTGCAGCCATTGTAATGAGGACAGTGCGTAATATTGTTAATACAGGACGGACCATTGTCTGCACAATCCATCAGCCAAGTATTGACATATTTGAATCTTTTGATGAGCTTTTATTCATGAAGCGTGGAGGACAGCTTATATACGCTGGTCCCTTAGGTGCCAAATCGCGTAATCTGGTTGACTTTTTTGAGGCAATTCCAGGAGTGCCTAAAATCAGGGACGGCTATAATCCTGCTGCATGGATGTTGGAAGTTACAAGCACCCAAATGGAGCAGATTCTTGGAGTGGATTTTGCTGAATACTATCGGCAATCAAAATTATTTCAACAGACCAGAGAAATCGTCGAGGCCCTAAGCAGACCGAGCAGTGAATCAAAAGAACTTACTTTCGCCACGAAGTATGCTCAACCATTTTGTGCTCAGTATATGGCTTGCCTATGGAAGCACAACCTATCGTACTGGAGGAACCCTCAGTACACCGCAGTTAGATTCTTCTACACAGTTATTATTTCCTTGATGTTTGGGACAATTTGCTGGAAATTCGGTTCTAGAAGGGGGACCCAACATGATATATTCAATGCGATGGGTGCCATGTATGCAGCGGTGCTGTTCATAGGAATTACCAACGCCACTTCTGTTCAGCCTGTGATCTCCATCGAAAGATTTGTATCTTATAGAGAGCGAGCTGCTGGGATGTACTCAGCGTTGCCTTTTGCATTTTCTCTGGTCACTGTGGAGTTCCCTTACATCCTTGTGCAGTCACTCATATACGGTTCAATCTTCTACAGTTTGGGATCATTTGAGTGGACAGCAGCCAAGTTTCTGTGGTACCTGTTCTTCATGTACTTCACGTTGCTGTACTTCACTTTCTATGGCATGATGACGACGGCGATCACTCCAAACCATACCATTGCGCCTATTATTGCGGCTCCATTCTACACGCTGTGGAATCTCTTCTGTGGATTCATGATCCCAAGAAAGCGCATCCCAGTTTGGTGGAGGTGGTACTACTGGGCCAACCCGGTGTCGTGGACGCTCTACGGGCTCCTGACCTCTCAGTTCGGCGACCTGGACCAGCCCCTGCTTATGGCCGACGGCGTCACCTCCACCACCGTGGTGGCTTTCCTGGAGGAGCACTTCGGGTTTCGCCACGACTTCCTCGGCGCCGTTGCGGCCATGGTGGCCGGCTTCTGCGTCCTCTTCGCCGTCGTCTTCGCCCTGGCCATCAAGTACCTCAACTTCCAGCGGCGATGAGAGAGCAAGTGGTTCAGCTAGCTAGCTAGTATAGTAGCCACCGCCGACACAGACCCACCAAACGGATCGCAGCCTACTGTACATGCATACACCGATCAGTGCAGGAGGGCAGCAGCACAATGAATTATGAATGCGATGTACCTACCAGCGCGTCGTATTGGCACAGTTAATTTGCCCATTACCCCCAGAACATTTCGCCGGGGTAAATAATCTTCCGGTCGGTCACGGGAGCGAGAGTGAGAAAAAGTAAAGGGTACTGTATAGCC


Protein sequences

Name Description Sequence
Zm.95124 translated coding region predicted by ESTScan from UniGene Zm.95124

CLRLPSHVDADTQRAFVEEVMELVELNPLSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGQLIYAGPLGAKSRNLVDFFEAIPGVPKIRDGYNPAAWMLEVTSTQMEQILGVDFAEYYRQSKLFQQTREIVEALSRPSSESKELTFATKYAQPFCAQYMACLWKHNLSYWRNPQYTAVRFFYTVIISLMFGTICWKFGSRRGTQHDIFNAMGAMYAAVLFIGITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGSIFYSLGSFEWTAAKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTIAPIIAAPFYTLWNLFCGFMIPRKRIPVWWRWYYWANPVSWTLYGLLTSQFGDLDQPLLMADGVTSTTVVAFLEEHFGFRHDFLGAVAAMVAGFCVLFAVVFALAIKYLNFQRRXESKWFSXLASIVATADTDPPNGSQPTVHAYTDQCRRAAAQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
2-500 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

LRLPSHVDADTQRAFVEEVMELVELNPLSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGQLIYAGPLGAKSRNLVDFFEAIPGVPKIRDGYNPAAWMLEVTSTQMEQILGVDFAEYYRQSKLFQQTREIVEALSRPSSESKELTFATKYAQPFCAQYMACLWKHNLSYWRNPQYTAVRFFYTVIISLMFGTICWKFGSRRGTQHDIFNAMGAMYAAVLFIGITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGSIFYSLGSFEWTAAKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTIAPIIAAPFYTLWNLFCGFMIPRKRIPVWWRWYYWANPVSWTLYGLLTSQFGDLDQPLLMADGVTSTTVVAFLEEHFGFRHDFLGAVAAMVAGFCVLFAVVFALAIKYLNFQRRXESKWFSX

HMMPanther: PTHR19241
2-500 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

LRLPSHVDADTQRAFVEEVMELVELNPLSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGQLIYAGPLGAKSRNLVDFFEAIPGVPKIRDGYNPAAWMLEVTSTQMEQILGVDFAEYYRQSKLFQQTREIVEALSRPSSESKELTFATKYAQPFCAQYMACLWKHNLSYWRNPQYTAVRFFYTVIISLMFGTICWKFGSRRGTQHDIFNAMGAMYAAVLFIGITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGSIFYSLGSFEWTAAKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTIAPIIAAPFYTLWNLFCGFMIPRKRIPVWWRWYYWANPVSWTLYGLLTSQFGDLDQPLLMADGVTSTTVVAFLEEHFGFRHDFLGAVAAMVAGFCVLFAVVFALAIKYLNFQRRXESKWFSX

superfamily: SSF52540
7-129 P-loop containing nucleoside triphosphate hydrolases

HVDADTQRAFVEEVMELVELNPLSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGQLIYAGPLGA

Gene3D: G3DSA:3.40.50.300
8-126 no description

VDADTQRAFVEEVMELVELNPLSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGQLIYAGP

HMMPfam: PF00005
IPR003439
13-70 ABC_tran
ABC transporter-like

QRAFVEEVMELVELNPLSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTS

HMMPfam: PF01061
IPR013525
216-429 ABC2_membrane
ABC-2 type transporter

QYMACLWKHNLSYWRNPQYTAVRFFYTVIISLMFGTICWKFGSRRGTQHDIFNAMGAMYAAVLFIGITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGSIFYSLGSFEWTAAKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTIAPIIAAPFYTLWNLFCGFMIPRKRIPVWWRWYYWANPVSWTLYGLLTSQF

Seg: seg
349-366 seg

FLWYLFFMYFTLLYFTFY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox