PRGDB00064373 (Zm.95177)

From PRG Wiki
Jump to: navigation, search
Zm.95177
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195623243 (EU961334)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 234594 mRNA sequence

DNA Sequence

ATACAAAACCAGCCGAGCGCCAGAGGAGAAGAGCTCCGTCTTGCCTTCTCTTCTCTACCTGCCGCACCCGCACAGCCACAGCCAACCACACACCCCACATCACAACAGCTCCCTCTGCATCTCCGCCTCGTCGCCGTCGTCTGCCTGCACAAccttcttcttcctcatctctctctctctTCTTCCGCTGCCACCCTCCCAGCACCGAGGGAAGGGAAGCCCAGGAATCTCCGTCCCGCTCCCGGCCGCCGTCCTTCTCATAACCTCATCGGATCTGTATTGGGTTTTCAGTAAGGAGCAGAAAACGCCTTAGGGAATGCAGAAAGATGTGCTTGCACGTCGAAGAGCTACTTTGTGAGGGACTTGGCAGGAAAGCACGCCATACTCTTCATTCTCTGCCACCTCTTGATGACTTCGAAGCTCAAGAGTACACGTATCTCCACCTCGTGCTTTCGCACAATGGGGTTCGACGTGGCGGCTCAACCGTCTTCTTAGATCACCATCTCGGTGGAGACGGTTGAAGTCTTCACACCCTCTCGACCTCTTTGCTGTCTCAttttttttAACTGTCAAGGATAAGCAAGTGACCTCTGTGTGCATACCACCACCACCATACGTAGCATACACAGGCACAGATGGCAGAGCATAAAGGGAACGTTCTCTTGCACAAGTATGAGATGGGGAAATTGCTTGGCCAAGGCACCTTTGCCAAGGTTTACCATGCTCGTAACACGGCGACTTCGGAAAGTGTCGCGATCAAAGTGATTGATAAGGAGAAGGTTATGAAGGTTGGTCTCATTGATCAAATCCAGCGAGAAATTTCTGTGATGAAGCTTGTTAGGCATCCAAACATCGTACAGCTCTATGAGGTCATGGCCACCAAAACCAAAATATACTTTGTGCTGGAACATGTTAAAGGTGGAGAGCTGTTCAACAAGATTCAGCGAGGAAGGCTCAAGGAAGACGCAGCGAGGAAGTACTTCCAGCAGTTGATCTGTGCGGTGGACTTCTGCCACAGCAGGGGTGTCTATCATCGAGATTTGAAGCCAGAAAATCTTTTGCTCGATGAGAATAGCAACCTAAAGGTATCAGATTTTGGTCTAAGCGCACTTGCTGAATGCCATAGACAAGACGGCCTGCTCCACACGACTTGTGGCACGCCTGCTTATGTTGCCCCAGAGGTGATTAACAGAAAGGGTTATGATGGTGCAAAGGCTAACATATGGTCTTGTGGGGTCATCCTGTTTGTGCTATTGGCTGGTTATCTTCCGTTCCATGATAAGAACTTGATGGACATGTATAAGAAGATTGAGAAAGCTGACTTCAAATGTCCAAGTTGGTTTTCTACCGATGTTCGGAGGCTTTTGCAAAGGATTCTTGATCCTAACCCTAGTAGAAGGATCTCGATGGAAAAAATCATGGAGAATCCATGGTTTAGGAAGGGTTTAGGTGCAAAGCTACTTAGGTACGATTTACAGAATAAGAATGCCCCTCATGTGGACAAGAATGCAGATTTTGATTCACTGAGCGCCAACATAACAACTGAGAGCAAGCAACATGAAGAAAAGAAGCCTATCAACATGAATGCATTTGATATAATCTCTCTATCAACTGGCTTGGACCTCTCTGGTTTATTTGAAGAATCTAACAAGAAGAGAGAATCCAAATTCACATCTACCAACACAAGCTCGACAATCATATCGAAGATCGAAGATATTGCAAAGAATTTGCGGTTGAATTTGACAAAGAAGGATGGTGGTTTGTTAAAGATGGAAGCTTCAAAGCCCGGAAGGAAAGGGGTAATGGGTATCGATGCCGAAGTATTTGAGGTTAGCCCTAACTTTCATCTTTAACATCCCACCACCTCGTGGCCCCCTCTGGATCCTGGGCGATGTTTTCATGGGAGTCTACCACACCGTCTTCGATTACGGCAAGCTGAGGGTTGGCTTCGCGGAGTCGGCCTAAGGAACGTATGGTTTGGCGCCTCCTCCAGAGGAGGCAAAACGCATGCGCCGAGAGAAAAGCTTCGCTTGTTTTTAACTTGTGTATTTATGCGGCCGGCGGTGTGTGTATATATGCTACATGTTTAGTGATGCTTTCCGAGACCTGAGACAATGCCCGTCTGTTTTAACCTGGCACAAGGAAATTTCTCGATGTGTTTGCCAAGCCAATCTTGTACCCAATTGTCACCGTGCATCCTGGCAACGTGTACTCAAAGTATTTTTCCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.95177 translated coding region predicted by ESTScan from UniGene Zm.95177

IQNQPSARGEELRLAFSSLPAAPAQPQPTTHPTSQQLPLHLRLVAVVCLHNLLLPHLSLSSSAATLPAPREGKPRNLRPAPGRRPSHNLIGSVLGFQXGAENALGNAERCACTSKSYFVRDLAGKHAILFILCHLLMTSKLKSNVSPPRAFAQWGSTWRLNRLLRSPSRWRRLKSSHPLDLFAVSFFLTVKDKQVTSVCIPPPPYVATQAQMAEHKGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWFRKGLGAKLLRYDLQNKNAPHVDKNADFDSLSANITTESKQHEEKKPINMNAFDIISLSTGLDLSGLFEESNKKRESKFTSTNTSSTIISKIEDIAKNLRLNLTKKDGGLLKMEASKPGRKGVMGIDAEVFEVSPNFIFNIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAESA

Domains

Domain Start-End Description Sequence

Seg: seg
17-39 seg

SSLPAAPAQPQPTTHPTSQQLPL

Seg: seg
49-69 seg

LHNLLLPHLSLSSSAATLPAP

Seg: seg
159-176 seg

RLNRLLRSPSRWRRLKSS

superfamily: SSF56112
IPR011009
210-509 Protein kinase-like (PK-like)
Protein kinase-like domain

AQMAEHKGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWFRKGLGAKLLRYDLQNKNAPHVDKNADFDSLS

Gene3D: G3DSA:3.30.200.20
211-320 no description

QMAEHKGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKE

HMMPanther: PTHR24347:SF45
216-495 SUBFAMILY NOT NAMED,MYOSIN LIGHT CHAIN KINASE 3

KGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWFRKGLGAKLLRYDLQNKN

HMMPanther: PTHR24347
IPR020636
216-495 FAMILY NOT NAMED
Calcium/calmodulin-dependent/calcium-dependent pro

KGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWFRKGLGAKLLRYDLQNKN

ProfileScan: PS50011
IPR000719
224-478 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWF

HMMPfam: PF00069
IPR017442
224-478 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWF

HMMSmart: SM00220
IPR002290
224-478 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWF

HMMSmart: SM00219
IPR020635
224-482 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWFRKGL

PatternScan: PS00107
IPR017441
230-253 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYHARNTATSESVAIK

Gene3D: G3DSA:1.10.510.10
321-523 no description

DAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVAPEVINRKGYDGAKANIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDVRRLLQRILDPNPSRRISMEKIMENPWFRKGLGAKLLRYDLQNKNAPHVDKNADFDSLSANITTESKQHEEKK

PatternScan: PS00108
IPR008271
342-354 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
522-546 NAF
NAF/FISL domain

KKPINMNAFDIISLSTGLDLSGLFE

HMMPfam: PF03822
IPR004041
523-582 NAF
NAF domain

KPINMNAFDIISLSTGLDLSGLFEESNKKRESKFTSTNTSSTIISKIEDIAKNLRLNLTK

Seg: seg
557-567 seg

TSTNTSSTIIS

superfamily: SSF50630
IPR021109
610-653 Acid proteases
Peptidase aspartic

VSPNFIFNIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAESA

Gene3D: G3DSA:2.40.70.10
IPR009007
614-653 no description
Peptidase aspartic, catalytic

FIFNIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAESA

HMMPfam: PF00026
IPR001461
618-651 Asp
Peptidase A1

IPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox