PRGDB00064376 (Zm.95391)

From PRG Wiki
Jump to: navigation, search
Zm.95391
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223944366 (BT061570)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0159O08 mRNA, complete cds

DNA Sequence

CGGCGCGGAACGAGCTTCCTTCCAGTCCCATGCGGGCCGGTAGCCGCCAGCAGAGCTCGCGTCTGCCTGGGACTGGGAGCGACGTCTCGCTCGCTTTCCCCCCTTTCCTGTACCCTGTGTGATGTGAGGAATGACGGTCTCCGCACTCATGGTCCTCCCCGGTCGCGGTCGCCCTCCACGGTTGCTCACCCTTGAGGAGGCGGAGGCGGCTCACGGGCTCTGATTGGCGGATGGCGCGTCGGATCGGAGCAGTCGAGCTTCGGGGATTTCCTGTCCCTCTGGAAGGGATGAAATGCGGCGACTACCTGGTGAACTGGGTGGAGCTCTAGTGCCAGCCAGTGTTCCTGCTGACGCCTGCCTCATCTAGTCCCCCCTTCGTTCAGTTCTTGTGGCGAGTTGTTAATCCACCGTGTCCGGGATCCGTTTGGCCTGGGGTTTTGAGGAGATGGACGACGAGGACTACTCGTGGGTGCGGCGCACCAGGTTCTCGCAGTCCATCGTCAGATCCAGCTCTGGCAGGGAGCAGTATGGCGCGTTCATCGAGCAGTTCAGCCGTGGCGCCGAGCTGAGGCAGAATGGGTTGGGCACAGGGTACAGGAACCCTCGCCAGAGTGTACAGCCCTTGGCGAAGGGATCCGGGGTCTCCAACTCTGCAAGGCTGCCGATTCCCAAGGCGAAGTCAGCAGTTGCCCAGTCGGAACGGAAGCTGAAGCATGCGTCTTCCGAAGGCCAATTGAACAGAGACGGTGATCGCCCGTTGCAAGAATCATCGGCGAAGCAGAGCCGGAAAGGGGCCGTCGGCCTCAGTCTGGACATTCCGCAGCTGCATGTGGTTCGGCCATCCAAGGAGAGCCCAGACGCGCTGGATTTCTCTTTCCACTCGGACGAGCACAGCCAGAGGCTCCAGAGAGTGTGTTCCAGCCCGGCTCCTTTCTCTACGAAGGATGGTACGGCACCAGCTGGTGATTCCAGAGCGAGCAGTGCATCTATGAAGATCATCGGACAAGTGTCCAAACCCGCGCCGAAACGAAGAGCCAAGTCCCCTATCCCCAAGCGCGTCATCTCGGATGTGTTTAAGGAGGCGAAAGCAGCCACCAAGAGGTTCTCCAGCCCGCAGCGGCAGAGGAAGCCCACATCTCCACGGTCACTAGATGACAGCCCTCCATTCGGCTTTGCTTCGCTAAGAACACCAAGCAAGCTGAAGATTAATAGCAGAACCTCCTCATGGCCGAGAAGGAACCTCGACAGTGGGCTGGCGAAAGTTGCTGCACTGGAGATCCTTGAGAGGTGGACGGTCGATCGCTCTGAGTTGCTCATTGGACATAGGTTTGCATCCGGGGCTTATAGCCGATTGTTCCATGGGATCTACAAGGAGCAACCTGTTGCTGTAAAGTTTATCAGACAGCCTGACGATGGTGAGGATGACGAATTATCTGCTAAGCTTGAGAAGCAGTTCACTTCAGAGGTTACCATTCTGGCAAGGCTCCAACATCGTAATGTCATTAAGCTTGTTGGGGCCTGTAATTGCCCGCCAGTATTCTGTGTAATCACTGAGTTTCTGTCTGGGGGTTCTTTGAGGGCTTTCTTGCGAAAGTTGGAGCGCAAAGCTCTTCCTTTGGAGAAGGTCATTTCCATCGCTTTGGATATCGCCCGCGGCCTGGAATATATTCACCTCCAGGGAATCGTACACCGTGACGTCAAACCCGAGAACATCTTATTTGATGGAGAATTCTGTGCTAAAGTTGTCGATTTTGGAGTGGCGTGTGAAGAAACATACTGCAATTTGTTAGGGGATGATCCAGGTACTTATAGATGGATGGCACCAGAGATGTACAAGCACAAGCCCTATGGCCGGAAAGTTGATGTGTATAGCTTTGGGCTTCTCTTGTGGGAATTGGTCACCGGTTCACTCCCTTATGAAGATATGACTCCGCTTCAGGCAGCTTTCGCCGTTGTTAATAAGAACTTGAGGCCGGTCATTCCATTGAGCTGCCCAGCAGCGCTGAAGCTTCTGATTGAGCAGTGTTGGTCCTGGCAACCAGAAAAGAGGCCCGACTTTCAGCAGATAGTTTCTATCCTCGAAGATCTCAAGACAGTTCTTGAAACAGACGGAACACTCCACAAGGTCCCAAGCTCGATCTGCCAGGCCTTGGAATCCAATGATCAGAACAAGAAGAAGGCCGGTAACTGGATCCAGAGGCTGTCATACGCTCAACCTGATTTCTCCGGGCCTCCACCCCCAAAGTTACTGTAGCTACGCGTCTTCTTGTTCTTGGTAGCTTGTTTATCTGGTTGGTAGCAACTGTGTAAATTGAACCTTTCTTGTTTCTTGTTGAGAGACCACAGATTTCGTCATGGTATATACTCGGACAAAGTACATACATC


Protein sequences

Name Description Sequence
Zm.95391 translated coding region predicted by ESTScan from UniGene Zm.95391

XGAERASFQSHAGRXPPAELASAWDWERRLARFPPFPVPCVMXGMTVSALMVLPGRGRPPRLLTLEEAEAAHGLXLADGASDRSSRASGISCPSGRDEMRRLPGELGGALVPASVPADACLIXSPLRSVLVASCXSTVSGIRLAWGFEEMDDEDYSWVRRTRFSQSIVRSSSGREQYGAFIEQFSRGAELRQNGLGTGYRNPRQSVQPLAKGSGVSNSARLPIPKAKSAVAQSERKLKHASSEGQLNRDGDRPLQESSAKQSRKGAVGLSLDIPQLHVVRPSKESPDALDFSFHSDEHSQRLQRVCSSPAPFSTKDGTAPAGDSRASSASMKIIGQVSKPAPKRRAKSPIPKRVISDVFKEAKAATKRFSSPQRQRKPTSPRSLDDSPPFGFASLRTPSKLKINSRTSSWPRRNLDSGLAKVAALEILERWTVDRSELLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSILEDLKTVLETDGTLHKVPSSICQALESNDQNKKKAGNWIQRLSYAQPDFSGPPPPKLL

Domains

Domain Start-End Description Sequence

Seg: seg
62-89 seg

LLTLEEAEAAHGLXLADGASDRSSRASG

HMMPanther: PTHR23257:SF81
151-751 PROTEIN-TYROSINE KINASE,PROTEIN-TYROSINE KINASE

DDEDYSWVRRTRFSQSIVRSSSGREQYGAFIEQFSRGAELRQNGLGTGYRNPRQSVQPLAKGSGVSNSARLPIPKAKSAVAQSERKLKHASSEGQLNRDGDRPLQESSAKQSRKGAVGLSLDIPQLHVVRPSKESPDALDFSFHSDEHSQRLQRVCSSPAPFSTKDGTAPAGDSRASSASMKIIGQVSKPAPKRRAKSPIPKRVISDVFKEAKAATKRFSSPQRQRKPTSPRSLDDSPPFGFASLRTPSKLKINSRTSSWPRRNLDSGLAKVAALEILERWTVDRSELLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSILEDLKTVLETDGTLHKVPSSICQALESNDQNKKKAGNWIQRLSYAQPDFSGPPPPKLL

HMMPanther: PTHR23257
151-751 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

DDEDYSWVRRTRFSQSIVRSSSGREQYGAFIEQFSRGAELRQNGLGTGYRNPRQSVQPLAKGSGVSNSARLPIPKAKSAVAQSERKLKHASSEGQLNRDGDRPLQESSAKQSRKGAVGLSLDIPQLHVVRPSKESPDALDFSFHSDEHSQRLQRVCSSPAPFSTKDGTAPAGDSRASSASMKIIGQVSKPAPKRRAKSPIPKRVISDVFKEAKAATKRFSSPQRQRKPTSPRSLDDSPPFGFASLRTPSKLKINSRTSSWPRRNLDSGLAKVAALEILERWTVDRSELLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSILEDLKTVLETDGTLHKVPSSICQALESNDQNKKKAGNWIQRLSYAQPDFSGPPPPKLL

Gene3D: G3DSA:3.30.200.20
423-506 no description

AALEILERWTVDRSELLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVG

superfamily: SSF56112
IPR011009
424-725 Protein kinase-like (PK-like)
Protein kinase-like domain

ALEILERWTVDRSELLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSILEDLKTVLETDGTLHKVPSSICQALESNDQNK

ProfileScan: PS50011
IPR000719
438-701 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSILEDLKTVL

HMMSmart: SM00219
IPR020635
438-694 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSIL

HMMSmart: SM00220
IPR002290
438-693 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LLIGHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSI

HMMPfam: PF07714
IPR001245
441-694 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

GHRFASGAYSRLFHGIYKEQPVAVKFIRQPDDGEDDELSAKLEKQFTSEVTILARLQHRNVIKLVGACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVSIL

Gene3D: G3DSA:1.10.510.10
507-692 no description

ACNCPPVFCVITEFLSGGSLRAFLRKLERKALPLEKVISIALDIARGLEYIHLQGIVHRDVKPENILFDGEFCAKVVDFGVACEETYCNLLGDDPGTYRWMAPEMYKHKPYGRKVDVYSFGLLLWELVTGSLPYEDMTPLQAAFAVVNKNLRPVIPLSCPAALKLLIEQCWSWQPEKRPDFQQIVS

FPrintScan: PR00109
IPR001245
518-531 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFLSGGSLRAFLR

FPrintScan: PR00109
IPR001245
556-574 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YIHLQGIVHRDVKPENILF

PatternScan: PS00108
IPR008271
562-574 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKPENILF

FPrintScan: PR00109
IPR001245
602-612 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEMY

FPrintScan: PR00109
IPR001245
621-643 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVYSFGLLLWELVTGSLPYEDM

FPrintScan: PR00109
IPR001245
665-687 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CPAALKLLIEQCWSWQPEKRPDF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox