PRGDB00064378 (Zm.95697)

From PRG Wiki
Jump to: navigation, search
Zm.95697
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194690207 (BT034183)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0029L07 mRNA, complete cds

DNA Sequence

CGGGCACACCACCGCACATGTGTTGTGTGTTTTGCGCAAGACCGCCGGACCAGAGACCGTCCGCCCCGCCCGCCGGTCACGCACGCCGTCTCGCGCCACCCAGCCGTCCGTCGGCTGGTCCGCTGACTCTTCGCCCCCCGCGTGTCCTGTCTGTGGTGGCGCGGCGCGGGACGGAAGCACGCAGCAGCAGCAGGTCAGGTAGGTGGTGGTGGGGATGCCGGCCGCGGCGCGGTCGTGGACGTGGACCTGCGGGTGCtgcgcgggcaggaggcggaccagcggcggcgctgcgggcgacacggccggcgcgtcggggcgcgCCGCCGAGGAGGGGGACGAGTGGAGCCTCTTCATCGACCTGCCCGTCCTCGAGGCCGCCACCGGCGGCTTCTCCGACGACAACCTCCTCGGCCGCGGCGGCTTCGGCCCCGTCTACAAGGGGGTGATGGAGAATGGGCAGCAGATCGCTGTGAAGAGGCTGTCTCTGGGGTCACGGCAAGGCGTGCGCGAGTTCCTGAACGAGGTCCGGCTCCTGCTCAAGGTGCAGCACCGGAACCTGGTGTCCCTGCTTGGCTGCTGTGCTTCCTCCGGCCACAAGATGCTCGTCTATCCCTACTTCCCCAATAGCAGCCTCGACCACACTCTCTTCGACAGGAATAAGTGTGCGGCGCTAGATTGGCCAAAACGGTACCATATAATCGTGGGACTGGCAAGAGGGCTCCTCTACCTGCACGAAGAGTCTCCGGTAAAGATCATCCACCGAGACATCAAGGCGAGCAACGTGCTCCTGGACGACCAGCTGAACCCGAAGATCTCGGACTTCGGCATGGCGAGGCTCTTCCTGGAGGACGCCACGCACGTGAACACGTTCAGGATCTCCGGCACATATGGTTACATGGCTCCAGAGTACGCGATGAACGGCTACCTGTCCGCCAAGACCGACGTCTTCAGCTTCGGGATCCTGGTGCTGGAGATCGTGAGCGGGCGGAAGAACATCGTCCGGCATCTGGACGACGAGAAGGTCGACCTGTTGAGCTATACATGGAAGCTATTCGGAGAAGGACGGTCCCTGGAGATCGTGGACCCGTCGCTGTCCAGCCCCGACAGCGATCAGGCGCTGCTGTGCATCCAGCTCGGCCTGCTGTGCTGCCAGGCCGCGGTGTCGGACCGGCCCGACATGCACAGCGTGCACCTGATGCTGTCGAGCGACTCGTTCACGCTGCCCAGGCCCGGGAAGCCGGCCGTACACGGCAGGACCGGCCGGTGGACGGCAGCGACGACGACGGCCTCAGGGTCCGCGTCGGCGTCGAGCGCCACCAACACCACCAGCACGTTCGGGTTCGGCACCGACACGAACACGACCAGGGCCTCTGCGCTGCTGGCCAGTGTCGCCGAGGACGAGTCCCGGAACTCCATCTCCATATCCTTCACCACTGATGGCCGGTAGGCGCAGTGCAGAGTGTATAAGGGAACGATACATGAGTGAGTGAACCAGAGTGATTTGTGAGGAGGGTATTGTTTGGTACTCCTAGCTAGCTAGGTAGATTAGGTTGATTTTGTAGAATCCCAGCCATATGGCGTACAGTTGGGTTGGGCCGTTGGGGCTTGGTAGAATGCTGAACTGTTGATCACTCTGTTTTACTAGTAACAGCGAAACCTATGGTTTGTCAACCGCG


Protein sequences

Name Description Sequence
Zm.95697 translated coding region predicted by ESTScan from UniGene Zm.95697

XGHTTAHVLCVLRKTAGPETVRPARRSRTPSRATQPSVGWSADSSPPACPVCGGAARDGSTQQQQVRXVVVGMPAAARSWTWTCGCCAGRRRTSGGAAGDTAGASGRAAEEGDEWSLFIDLPVLEAATGGFSDDNLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPYFPNSSLDHTLFDRNKCAALDWPKRYHIIXGTGKRAPLPARRVSGKDHPPRHQGEQRAPGRPAEPEDLGLRHGEALPGGRHAREHVQDLRHIWLHGSRVRDERLPVRQDRRLQLRDPGAGDRERAEEHRPASGRREGRPVELYMEAIRRRTVPGDRGPVAVQPRQRSGAAVHPARPAVLPGRGVGPARHAQRAPDAVERLVHAAQAREAGRTRQDRPVDGSDDDGLRVRVGVERHQHHQHVRVRHRHEHDQGLCAAGQCRRGRVPELHLHILHHXWPVGAVQSV

Domains

Domain Start-End Description Sequence

Seg: seg
22-34 seg

RPARRSRTPSRAT

Seg: seg
62-71 seg

QQQQVRXVVV

Seg: seg
83-109 seg

TCGCCAGRRRTSGGAAGDTAGASGRAA

superfamily: SSF56112
IPR011009
103-236 Protein kinase-like (PK-like)
Protein kinase-like domain

GASGRAAEEGDEWSLFIDLPVLEAATGGFSDDNLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPYFPNSSLDHTLFDRNKCAALDWPKRYHIIXG

HMMPanther: PTHR24420
110-237 FAMILY NOT NAMED,FAMILY NOT NAMED

EEGDEWSLFIDLPVLEAATGGFSDDNLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPYFPNSSLDHTLFDRNKCAALDWPKRYHIIXGT

Gene3D: G3DSA:3.30.200.20
123-206 no description

VLEAATGGFSDDNLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPY

ProfileScan: PS50011
IPR000719
131-489 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDDNLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPYFPNSSLDHTLFDRNKCAALDWPKRYHIIXGTGKRAPLPARRVSGKDHPPRHQGEQRAPGRPAEPEDLGLRHGEALPGGRHAREHVQDLRHIWLHGSRVRDERLPVRQDRRLQLRDPGAGDRERAEEHRPASGRREGRPVELYMEAIRRRTVPGDRGPVAVQPRQRSGAAVHPARPAVLPGRGVGPARHAQRAPDAVERLVHAAQAREAGRTRQDRPVDGSDDDGLRVRVGVERHQHHQHVRVRHRHEHDQGLCAAGQCRRGRVPELHLHILHHXWPVGAVQSV

HMMSmart: SM00219
IPR020635
131-298 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDDNLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPYFPNSSLDHTLFDRNKCAALDWPKRYHIIXGTGKRAPLPARRVSGKDHPPRHQGEQRAPGRPAEPEDLGLRHGEALPGGRHAREHVQDLRHIW

HMMPfam: PF07714
IPR001245
135-220 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NLLGRGGFGPVYKGVMENGQQIAVKRLSLGSRQGVREFLNEVRLLLKVQHRNLVSLLGCCASSGHKMLVYPYFPNSSLDHTLFDRN

Seg: seg
432-454 seg

RVRVGVERHQHHQHVRVRHRHEH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox