PRGDB00064379 (Zm.95796)

From PRG Wiki
Jump to: navigation, search
Zm.95796
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223947012 (BT062893)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0004N02 mRNA, complete cds

DNA Sequence

CCCCATCATGCCGCATCACGGCATCACGCGCGTGCCTTCCTCGACCCTCGCTACTGCTACTGTCTCGTCTCTTGCTCGCATCGTCTGGGGACCGCGGAGCGGCGGCGGCGTGGCGCAGCGGCACGGCAgcctccccctcgctcctcctactccggctcttcccctctccccctcagccctacgcccctGCGCGGCTGCGTGACCTGCGTCCAGCCGCAGCGGCTGGTGCCCATCGGCGGCAAGTAGCAGAGCAGCAGCAGCCGCCGGCGGtcctcccctccccctcggcctcgctccggctctcccagtcccagctcgAGCTCCGTACTGAAGGTTGAAGCAAGGCCTCCATCTTTGAGACCCTCGCGGGCGACGAGCTCTAGTCTTCTGTTCCTGCTGTGCGAGACGGAGCACCCAAACCCAAGCTATTTATATTCGGATCTGATCTGATCCAATTACAAGTGTAGTTTACACGACCCAAAACAGATTGCCGCCATCAAAGATGGAATCTGGGAGCACGTTCTATGGAGGGGAAGGTCTCTCCATCGACCCCAAGTGGTTTATCGACCCGAAGCTTCTCTTTGTTGGGCCACGCATCGGCGAGGGCGCTCATGCAAAGGTCTATGAGGGGAAGTATAAGAACCAAAATGTTGCTATCAAGATTGTGCACAAAGGGGACACCCCTGAGGAGATGACCAAGAGGGAGGGGAGATTCTTGAGAGAGGTGACCATGCTGTCAAGGGTGCAGCACAAGAACCTCGTCAAGTTTATTGGGGCCTGCCTAGAACCTGTCATGGTGGTCGTGACAGAGCTACTAGTGGGGGGTTCGTTGCGCAAGTATTTGGTCAGTCTCCGACCTAGGAGCCTTGAGCCTCGTGTAGCAGTGGGGTTTGCATTGGACATTGCCCGAGCTATGGAATGCTTACATGCACATGGGATCATTCATCGTGATCTTAAGCCTGAGAATCTGTTGCTGACTGCAGACCAGAGAACAGTAAAACTTGTTGATCTTGGTTTGGCTAGGGAAGAGACACTAACGGAGATGATGACTGCTGAGACAGGAACATACCGTTGGATGGCTCCAGAGTTGTACAGCACAGTAACACTGAGGCATGGAGAAAAGAAGCATTACAACCACAAAGTAGATGTCTACAGCTTTGCAATTGTGTTGTGGGAACTCCTCCACAATAAACTGCCCTTCGAGGGAATGTCTAACCTTCAAGCTGCCTACGCTGCCGCTTTCAAGAATATCAGACCAAGTGCCGATAACTTGCCCGAGGAGCTGTCAGAAATCCTAACATCCTGCTGGAAGGAAGACCCAAACGACAGACCAAACTTCACACAGATAATACAGATGCTCCTACACTACCTATCCACCCTTTCGCCACAAGAGACCTTGGCGGGCCCCCGCCGCACGTTCAGTTCGGAGAACACAATCCTGCCCCCAGAGTCTCCCGGGACAAGCTCGCTGATGGCTTCGCGGGGCGACCTCGGCGACACGCCCAAGGGCAAGAAGGAAGACAAGCCGAGGGGCTTCTTCTTCTGTTTCAGCGAGTGCTATTAGCACGAGCCCCCCCAAAGGGGGAACACTCCGATAAGCTTGCAAATACTGAACGAACACCGTCTCTCCCCAGCTCCGATGCCCTGCGACTCAAGCCATGTCCAGCCGGTCAAGTCCCAGGCATCCATAGTCCGCACCCTGAAGAACGGAAGTGTAGTCGAACACTGTTTTGTTTTCTTCTGCTAATCAAGGTCTCCTGCATCGCTGACATGCTGATGACATATACCAGCAGGGTAAAACGACGGGTAAACCTTTTGACTCCAGATAGTAATGGTGGGAATAGCTTACCTCCCCTGTGTTTTCTGGCGCACCATGGTGTAACGGAGTTGCTAGAGCGCGACTATAGATTGCCTTCCTGCCTGCCTGTCTCGCCCGACATCGTATAGAAATAAAACCAATAATTCGCATC


Protein sequences

Name Description Sequence
Zm.95796 translated coding region predicted by ESTScan from UniGene Zm.95796

XPIMPHHGITRVPSSTLATATVSSLARIVWGPRSGGGVAQRHGSLPLAPPTPALPLSPSALRPCAAAXPASSRSGWCPSAASSRAAAAAGGPPLPLGLAPALPVPARAPYXRLKQGLHLXDPRGRRALVFCSCCARRSTQTQAIYIRIXSDPITSVVYTTQNRLPPSKMESGSTFYGGEGLSIDPKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELSXNPNILLEGRPKRQTKLHTDNTDAPTLPIHPFATRDLGGPPPHVQFGEHNPAPRVSRDKLADGFAGRPRRHAQGQEGRQAEGLLLLFQRVLLARAPPKGEHSDKLANTERTPSLPSSDALRLKPCPAGQVPGIHSPHPEERKCSRTLFCFLLLIKVSCIADMLMTYTSRVKRRVNLLTPDSNGGNSLPPLCFLAHHGVTELLERDYRLPSCLPVSPDIV

Domains

Domain Start-End Description Sequence

Seg: seg
14-26 seg

SSTLATATVSSLA

Seg: seg
44-72 seg

SLPLAPPTPALPLSPSALRPCAAAXPASS

Seg: seg
78-109 seg

PSAASSRAAAAAGGPPLPLGLAPALPVPARAP

superfamily: SSF56112
IPR011009
176-489 Protein kinase-like (PK-like)
Protein kinase-like domain

YGGEGLSIDPKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELSXNPNILLEGRPKRQTKLHTDNTDAPTLPIHPFATRDLGGPPPHVQFGEHNPAPRVSRDK

HMMPanther: PTHR23257:SF83
IPR015784
181-430 PROTEIN KINASE ATN1
Serine/threonine-protein kinase, ATN1-like

LSIDPKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELS

HMMPanther: PTHR23257
181-430 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LSIDPKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELS

Gene3D: G3DSA:3.30.200.20
183-259 no description

IDPKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIG

ProfileScan: PS50011
IPR000719
194-463 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELSXNPNILLEGRPKRQTKLHTDNTDAPTLPIHPFA

HMMSmart: SM00219
IPR020635
194-494 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELSXNPNILLEGRPKRQTKLHTDNTDAPTLPIHPFATRDLGGPPPHVQFGEHNPAPRVSRDKLADGF

HMMSmart: SM00220
IPR002290
194-536 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEELSXNPNILLEGRPKRQTKLHTDNTDAPTLPIHPFATRDLGGPPPHVQFGEHNPAPRVSRDKLADGFAGRPRRHAQGQEGRQAEGLLLLFQRVLLARAPPKGEHSDKLA

HMMPfam: PF00069
IPR017442
198-409 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREVTMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQA

PatternScan: PS00107
IPR017441
200-221 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGAHAKVYEGKYKNQNVAIK

Gene3D: G3DSA:1.10.510.10
260-429 no description

ACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIARAMECLHAHGIIHRDLKPENLLLTADQRTVKLVDLGLAREETLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNKLPFEGMSNLQAAYAAAFKNIRPSADNLPEEL

PatternScan: PS00108
IPR008271
314-326 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPENLLL

Seg: seg
340-354 seg

LAREETLTEMMTAET

Seg: seg
513-522 seg

LLLLFQRVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox