PRGDB00064387 (Zm.96326)

From PRG Wiki
Jump to: navigation, search
Zm.96326
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 6527120 (AW216330)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

687049E09.x1 687 - Early embryo from Delaware Zea mays cDNA, mRNA sequence

DNA Sequence

ttttttttttttCCTTTTGAATCCAGGAACATGTTCTTAGTATTTCTTATCGATATCCCGTATATAAGAATTTGCTTCCTACTGGACCGATAACAGATGACTCACCTTCTCTAGTTCACCTTCTCTAGTATCTACaaaaaaaaaaGATGATGGCATATTAACCTGTTACATCATTACAACACGGGCACCCTATTGTCCCAATCACCCTGTGTTTCCAACGATCTCAACATCCTCCCCAGCCTTCGCCATTTCAATCTTAACGGAAGGTCCTGCCGAATCGGCATTGGTAATCGATTCGTCCTTGCTAGCAGATGCAGCTCCCTTCAGTCCCTTTTTCATCTTGACCTTCTGAGCCCAGCCCAGGACGCCCTGCTGCACATGCTCGTTGAAGATCTCCTTCTTGTAGCAGCTCCCCATCTGGGTTACAATTGCATACAGAGGCAAGGTGCTGTAGCTGCAGAGAAGCTGAATAACCACCCCGATGACAAGCCTTGGCACAATAAAACGAACTTGTCCCATGATGCACGAGTCGAATCCATAAGTGCTCAGTATCCAGAAGAAAAACGCAATCTCAAATGCATTCTGAAAGAGGATGAAGTGGATAAGGTAAAGGATAAGCCTAGGCTTGCCGAACCAGAAGTGTTCATCTGATGGTTTTACGAT


Protein sequences

Name Description Sequence
Zm.96326 translated coding region predicted by ESTScan from UniGene Zm.96326

IVKPSDEHFWFGKPRLILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMKKGLKGAASASKDESITNADSAGPSVKIEMAKAGEDVEIVGNTG

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-131 Mlo
Mlo-related protein

IVKPSDEHFWFGKPRLILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRFIVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMKKGLKGAASASKDESITNADSA

Seg: seg
108-121 seg

KMKKGLKGAASASK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox