PRGDB00064397 (Zm.97115)

From PRG Wiki
Jump to: navigation, search
Zm.97115
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195607375 (EU953400)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 1407001 disulfide oxidoreductase

DNA Sequence

ATCCGACTAAAAAGGGCCAGGGCCAGGGCCTTCGCTTGCTTACTACTCCTGCTTACCACACTCTACCTTGTCTCTTCACGTGCACACGACGCCTCCCCCAATGGCTGCGGTGGCGGAGGAGGAGGTGATCGTCGTCGGCGCGGGGCAGTCGGGGCTAGCGGTGGCGGCGTGCCTGTCCCTGCGCGGCGTGCGGGCGCTGGTCCTGGAGCGCGACGACTGCGTGGGGTCGCTGTGGCGGAAGCGCGCCTACGACCGCCTCCACCTCCACCTCACCAAGAAGTACTGCGCGCTGCCGCACGCGCCGCACCCGGCCGAGGCCCCCGCGTACCTGCACCGCGACGACTTCGCGCGGTACCTGGACGGGTAcgccgcgcggttcgccgtccgcccgcgcctccgccgcgaggtccggtcggcgcggtacgaccccgcgagcgcgcgGTGGGAGGTGGAGGCCGTGGACCTCGGCACGGGCCAGGCCGAGCGGTACGCGGCGAGGTTCCTGGTGGTCGCGTCCGGGGAGAACGCCGAGAAGTTCCTGCCGGAGGTGCCTGGGCTGGAGGCGTTCCCCGGCCAGGTGATGCACGCAGTGGAGTACCGGTCGGCCGAGGGGATGCGCGGGAAGGCCGTGCTCGTCGTGGGGTCGGGCAACTCCGGCATGGAGATCGCCTACGACCTCGCCGCCGCCGGCGCCGTCACCTCCATCGTCGTCCGAGGCGAGCTCCACCTGGTGACCAAGGAGATCTGGAACGTGGCGATGACGCTGTACCCGTACCTGCCCGTGTGGGTCATAGACAAGCTGGTGCTGCTCATGTGCGCCGTGGTGTTCGGCGACACGTCCCGGCACGGCCTCCGCCGCCCCGCCATCGGGCCCTTCACCATGAAGCTCACCACCCCGGGCTACCCCGTCGTGGACGTCGGCACCTACGCCAAGATCAGGAGCGGCGAGATCCGGGTGCTCCCCGCCGCCGTCAAGAGCGTCCGCGGGAACGTCGTCGAGTTCGGGGACGGCAGCCGCCACCCTTTCGACGCCATCGTCTTCGCCACCGGCTACCGGAGCACTGTCAGGCGGTGGCTCAAGAGCGAGGACGGGCTGGTCGGTGACGACGGGATGGCGGCGCGGAGCTACCCGGAGCACTGGAAGGGGGACCACGGGCTGTACTGCGCGGGGATGGTGCGGAGGGGCATCTACGGCAGCTGCGAGGACGCGGAGCTCATCGCCGCCGACATCAGCAAGCTGCTGCACCCCAAGCAGGAGCAGGGCAACGGCGTCTAGCTGCAGCTAGCATTTCGCTTTGTTGGTTGCGATGGAAACAAGCTCTATTGTTGTTGGGTTGGTTGATAATAATGGTTGCGTGAATAAAAAAATCTCTTCCCATGCACCGCCCGCTGCCGTGCCCGCCCTGCCCTCCACCTTCTCCCGGCGCAATAAACAAGtcgaggcgaggcgaggcggcagcggcggcggcggcATTGCCGAGATTTCCGTGATTCTTGCGCTTGTTAGTTGTGCTGTGTATAGTTGGGCCGGCCGGGGGTGGTTCCGTACAGTTCCTTCTCTGTTGGAGTAGTCGGCGGCGATGGGTATCCTCGCGCTCATCACCGGCAAGGCGGGCGCCAGCGGGTTCGGGTCGGCGTCCACGGCGGAGCATGTCACCGACGGCGCCGACGCCAGCCGCCTCACCGTCGCTATCACAGGAGGAGCTAGTGGCATTGGTCTGGAGACATCAAGAGTCTTCGCCCTGAGAGGAGCCCATGTGGTCATCGCTGCTAGAAACACAGAGGCTGCATCAGAAGCAAGAAAGACCATCATGGAGAAGAACCCAACGGCACGTATTGATGTTCTGAAGCTAGACCTCAGCTCCCTCAAGTCTGTCAGGGCTTTTGTGGACCAGTTCAACTCGATGAAACTCCCTCTAAACATCCTGATGTAACCCTCTTCACCTCTCGTtcatgcttgttttttgctttcatatatatgatagtttcctttgcttgttttttctttcatatatatgaaagtttccgcctgttttaaaaaaaaagaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.97115 translated coding region predicted by ESTScan from UniGene Zm.97115

XSDXKGPGPGPSLAYYSCLPHSTLSLHVHTTPPPMAAVAEEEVIVVGAGQSGLAVAACLSLRGVRALVLERDDCVGSLWRKRAYDRLHLHLTKKYCALPHAPHPAEAPAYLHRDDFARYLDGYAARFAVRPRLRREVRSARYDPASARWEVEAVDLGTGQAERYAARFLVVASGENAEKFLPEVPGLEAFPGQVMHAVEYRSAEGMRGKAVLVVGSGNSGMEIAYDLAAAGAVTSIVVRGELHLVTKEIWNVAMTLYPYLPVWVIDKLVLLMCAVVFGDTSRHGLRRPAIGPFTMKLTTPGYPVVDVGTYAKIRSGEIRVLPAAVKSVRGNVVEFGDGSRHPFDAIVFATGYRSTVRRWLKSEDGLVGDDGMAARSYPEHWKGDHGLYCAGMVRRGIYGSCEDAELIAADISKLLHPKQEQGNGVXLQQHFALLVAMETSSIVVGLVDNNGCVNKKISSHAPPAAVPALPSTFSRRNKQVEARRGGSGGGGIAEISVILALVSCAVYSWAGRGWFRTVPSLLEXSAAMGILALITGKAGASGFGSASTAEHVTDGADASRLTVAITGGASGIGLETSRVFALRGAHVVIAARNTEAASEARKTIMEKNPTARIDVLKLDLSSLKSVRAFVDQFNSMKLPLNILM

Domains

Domain Start-End Description Sequence

Seg: seg
6-11 seg

GPGPGP

superfamily: SSF51905
34-321 FAD/NAD(P)-binding domain

PMAAVAEEEVIVVGAGQSGLAVAACLSLRGVRALVLERDDCVGSLWRKRAYDRLHLHLTKKYCALPHAPHPAEAPAYLHRDDFARYLDGYAARFAVRPRLRREVRSARYDPASARWEVEAVDLGTGQAERYAARFLVVASGENAEKFLPEVPGLEAFPGQVMHAVEYRSAEGMRGKAVLVVGSGNSGMEIAYDLAAAGAVTSIVVRGELHLVTKEIWNVAMTLYPYLPVWVIDKLVLLMCAVVFGDTSRHGLRRPAIGPFTMKLTTPGYPVVDVGTYAKIRSGEIRVL

Seg: seg
36-49 seg

AAVAEEEVIVVGAG

HMMPanther: PTHR23023:SF5
38-421 MONOOXYGENASE,MONOOXYGENASE

VAEEEVIVVGAGQSGLAVAACLSLRGVRALVLERDDCVGSLWRKRAYDRLHLHLTKKYCALPHAPHPAEAPAYLHRDDFARYLDGYAARFAVRPRLRREVRSARYDPASARWEVEAVDLGTGQAERYAARFLVVASGENAEKFLPEVPGLEAFPGQVMHAVEYRSAEGMRGKAVLVVGSGNSGMEIAYDLAAAGAVTSIVVRGELHLVTKEIWNVAMTLYPYLPVWVIDKLVLLMCAVVFGDTSRHGLRRPAIGPFTMKLTTPGYPVVDVGTYAKIRSGEIRVLPAAVKSVRGNVVEFGDGSRHPFDAIVFATGYRSTVRRWLKSEDGLVGDDGMAARSYPEHWKGDHGLYCAGMVRRGIYGSCEDAELIAADISKLLHPKQEQ

HMMPanther: PTHR23023
38-421 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

VAEEEVIVVGAGQSGLAVAACLSLRGVRALVLERDDCVGSLWRKRAYDRLHLHLTKKYCALPHAPHPAEAPAYLHRDDFARYLDGYAARFAVRPRLRREVRSARYDPASARWEVEAVDLGTGQAERYAARFLVVASGENAEKFLPEVPGLEAFPGQVMHAVEYRSAEGMRGKAVLVVGSGNSGMEIAYDLAAAGAVTSIVVRGELHLVTKEIWNVAMTLYPYLPVWVIDKLVLLMCAVVFGDTSRHGLRRPAIGPFTMKLTTPGYPVVDVGTYAKIRSGEIRVLPAAVKSVRGNVVEFGDGSRHPFDAIVFATGYRSTVRRWLKSEDGLVGDDGMAARSYPEHWKGDHGLYCAGMVRRGIYGSCEDAELIAADISKLLHPKQEQ

FPrintScan: PR00411
42-64 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

EVIVVGAGQSGLAVAACLSLRGV

Gene3D: G3DSA:3.50.50.60
42-224 no description

EVIVVGAGQSGLAVAACLSLRGVRALVLERDDCVGSLWRKRAYDRLHLHLTKKYCALPHAPHPAEAPAYLHRDDFARYLDGYAARFAVRPRLRREVRSARYDPASARWEVEAVDLGTGQAERYAARFLVVASGENAEKFLPEVPGLEAFPGQVMHAVEYRSAEGMRGKAVLVVGSGNSGMEIA

FPrintScan: PR00368
IPR013027
43-62 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

VIVVGAGQSGLAVAACLSLR

HMMPfam: PF13738
44-240 Pyr_redox_3,Pyridine nucleotide-disulphide oxidoreductase

IVVGAGQSGLAVAACLSLRGVRALVLERDDCVGSLWRKRAYDRLHLHLTKKYCALPHAPHPAEAPAYLHRDDFARYLDGYAARFAVRPRLRREVRSARYDPASARWEVEAVDLGTGQAERYAARFLVVASGENAEKFLPEVPGLEAFPGQVMHAVEYRSAEGMRGKAVLVVGSGNSGMEIAYDLAAAGAVTSIVVRG

Seg: seg
99-109 seg

PHAPHPAEAPA

FPrintScan: PR00411
169-178 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

LVVASGENAE

FPrintScan: PR00411
210-235 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

AVLVVGSGNSGMEIAYDLAAAGAVTS

FPrintScan: PR00368
IPR013027
210-228 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

AVLVVGSGNSGMEIAYDLA

Gene3D: G3DSA:3.50.50.60
292-418 no description

PFTMKLTTPGYPVVDVGTYAKIRSGEIRVLPAAVKSVRGNVVEFGDGSRHPFDAIVFATGYRSTVRRWLKSEDGLVGDDGMAARSYPEHWKGDHGLYCAGMVRRGIYGSCEDAELIAADISKLLHPK

superfamily: SSF51905
310-372 FAD/NAD(P)-binding domain

YAKIRSGEIRVLPAAVKSVRGNVVEFGDGSRHPFDAIVFATGYRSTVRRWLKSEDGLVGDDGM

Seg: seg
480-497 seg

VEARRGGSGGGGIAEISV

Seg: seg
538-547 seg

AGASGFGSAS

superfamily: SSF51735
556-643 NAD(P)-binding Rossmann-fold domains

ADASRLTVAITGGASGIGLETSRVFALRGAHVVIAARNTEAASEARKTIMEKNPTARIDVLKLDLSSLKSVRAFVDQFNSMKLPLNIL

Gene3D: G3DSA:3.40.50.720
IPR016040
561-643 no description
NAD(P)-binding domain

LTVAITGGASGIGLETSRVFALRGAHVVIAARNTEAASEARKTIMEKNPTARIDVLKLDLSSLKSVRAFVDQFNSMKLPLNIL

HMMPfam: PF00106
IPR002198
562-643 adh_short
Short-chain dehydrogenase/reductase SDR

TVAITGGASGIGLETSRVFALRGAHVVIAARNTEAASEARKTIMEKNPTARIDVLKLDLSSLKSVRAFVDQFNSMKLPLNIL

Seg: seg
614-626 seg

DVLKLDLSSLKSV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox