PRGDB00064403 (Zm.98048)

From PRG Wiki
Jump to: navigation, search
Zm.98048
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 26456066 (CA827649)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

1114017F01.y2 1114 - Unigene IV from Maize Genome Project Zea mays cDNA, mRNA sequence

DNA Sequence

CATACATAGAGACTTAAAGACTGCCAACCTTCTAATGGACAACGATCATGCTGTGAAAGTGGCTGATTTTGGCGTAGCTCGGTTCCAGGATCAAGGAGGTATCATGACAGCTGAAACTGGAACATACAGATGGATGGCGCCTGAGGTTATAAACCACCAACCCTATGATAGCAAAGCAGATGTGTTCAGCTTTGCCATTGTTCTCTGGGAGCTGATAACGTCCAAGATCCCATATGATACCATGACCCCTCTCCAAGCGGCTGTAGGTGTGAGACAGGGGTTGCGCCCAGGACTTCCGAAGAAGACGCACCCAAAGCTGTTGGACTTGATGCAGAGATGTTGGGAAGCAGATCCATCCGACCGGCCTGCTTTCTCGGACATTTTACCCGAACTGGAGGATCTTTTGGCACAAGCTCAGGGAACATCGGGAAAGACGGTCCAAGATCCATCAAACTCGAACGCGAAAGATTAACCCCCATGCCATGCACATACCTGTCATTTTTTCTCAATCCAGTGATTTGCCACATCTAGGATTCGAGTTGCCAATTATGAGGAAATTTGTTTTGCTTGTGTACATTCGAACAATCTTCTTGGGGCCTATTTTTTATGGGCACCTCATTATTCTTATACAAAAGAAATTGGGCTCGACGCTTGCGATaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.98048 translated coding region predicted by ESTScan from UniGene Zm.98048

XIHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPELEDLLAQAQGTSGKTVQDPSNSNAKD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-136 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XIHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPELEDLL

superfamily: SSF56112
IPR011009
2-132 Protein kinase-like (PK-like)
Protein kinase-like domain

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPEL

Gene3D: G3DSA:1.10.510.10
2-154 no description

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPELEDLLAQAQGTSGKTVQDPSNSN

HMMPfam: PF07714
IPR001245
2-132 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPEL

HMMSmart: SM00219
IPR020635
2-132 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPEL

HMMSmart: SM00220
IPR002290
2-136 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPELEDLL

HMMPanther: PTHR23257
2-135 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPELEDL

HMMPanther: PTHR23257:SF82
2-135 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

IHRDLKTANLLMDNDHAVKVADFGVARFQDQGGIMTAETGTYRWMAPEVINHQPYDSKADVFSFAIVLWELITSKIPYDTMTPLQAAVGVRQGLRPGLPKKTHPKLLDLMQRCWEADPSDRPAFSDILPELEDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox