PRGDB00064426 (Zm.101007)

From PRG Wiki
Jump to: navigation, search
Zm.101007
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76928207 (DV171519)
Gene Class N
Domain Type NBS
Gene Species Zea mays

Comment?

ZM_BFb0172A01.r ZM_BFb Zea mays cDNA 5', mRNA sequence

DNA Sequence

GTCGCGCGATTCGACCACGTCCTACTCGTCGCGGCCTCCAGGGACTGCACGGTGGCCAAGCTCCAGAGGGAGGTCGTGTCCGTGCTCGGGCTGCGCGACGCGCCCACGGAGCAGGCGCAGGCCGCCGGGATCCTGAGCTTCCTGAGGGACAAGAGCTTCCTGCTGCTGCTGGACAGCGTGTGGGAACGTCTGGACCTGGAGAGGGTCGGCATCCCGCAGCCCCTCGGCATGGCTAACGGCAAGGTGAGGAAGATCATAGTGGCGTCGAGGAGCGAGGCCTTGTGCGCCGACATGGGCTGCCGCAACAAGATCAAGATGGAGTGCTTGAACGAGGAGGATGCGTGGAGCCTGTTTCAAGCTAATGTTGGCGGCGACATCATCCATGGCCACGCTCAAATTCCTGCACTTGCTAAACAGGTCGCTGCCGAATGCAAGTGCTTGCCTTTGGCCCTCGTCACCGTCGGCCGCGCAATGTCAAATAAGCGCACACCAGAGGAGTGGTCCAACGCACTCGACACCCTCAAGGCATCGCTCCGCTCCGGCACGCCCGGCTTGGACAAGAGCACGCAGGCGCTAGTGAAGTTCTGCTACGACAACCTGGAGAGCGACATGGTGAGGGAATGCTTCCTGACCTGTGCGCTATGGCCGGAGGACCACAACATCTCCAAGGAGGAGCTCGTGCAGAGCTGGATAGGACTCGGCCTGCTCCCCGATCTCAGCGACATCGAAGAGGCCCACAGGTTCGGGCTCTCGGTGATTGCCATCATGAAAGCCGCGTGCCTGCTGGAGCCCGGGGACAACCACCGCTACTACATGTTCCCGTCAGACACTCACGTCAGGATGCCCGAC


Protein sequences

Name Description Sequence
Zm.101007 translated coding region predicted by ESTScan from UniGene Zm.101007

XRAIRPRPTRRGLQGLHGGQAPEGGRVRARAARRAHGAGAGRRDPELPEGQELPAAAGQRVGTSGPGEGRIPQPLGMANGKVRKIIVASRSEALCADMGCRNKIKMECLNEEDAWSLFQANVGGDIIHGHAQIPALAKQVAAECKCLPLALVTVGRAMSNKRTPEEWSNALDTLKASLRSGTPGLDKSTQALVKFCYDNLESDMVRECFLTCALWPEDHNISKEELVQSWIGLGLLPDLSDIEEAHRFGLSVIAIMKAACLLEPGDNHRYYMFPSDTHVRMPD

Domains

Domain Start-End Description Sequence

Seg: seg
24-43 seg

GGRVRARAARRAHGAGAGRR

HMMPfam: PF00931
IPR002182
84-235 NB-ARC,NBS
NB-ARC

KIIVASRSEALCADMGCRNKIKMECLNEEDAWSLFQANVGGDIIHGHAQIPALAKQVAAECKCLPLALVTVGRAMSNKRTPEEWSNALDTLKASLRSGTPGLDKSTQALVKFCYDNLESDMVRECFLTCALWPEDHNISKEELVQSWIGLGL

superfamily: SSF52540
84-182 P-loop containing nucleoside triphosphate hydrolases

KIIVASRSEALCADMGCRNKIKMECLNEEDAWSLFQANVGGDIIHGHAQIPALAKQVAAECKCLPLALVTVGRAMSNKRTPEEWSNALDTLKASLRSGT

HMMPanther: PTHR10903:SF22
133-253 ATP BINDING / GTP BINDING / NUCLEOSIDE-TRIPHOSPHATASE/ NUCLEOTIDE BINDING / PRO,ATP BINDING / GTP BINDING / NUCLEOSIDE-TRIPHOSPHATASE/ NUCLEOTIDE BINDING / PRO

IPALAKQVAAECKCLPLALVTVGRAMSNKRTPEEWSNALDTLKASLRSGTPGLDKSTQALVKFCYDNLESDMVRECFLTCALWPEDHNISKEELVQSWIGLGLLPDLSDIEEAHRFGLSVI

HMMPanther: PTHR10903
133-253 GTPASE, IMAP FAMILY MEMBER-RELATED,GTPASE

IPALAKQVAAECKCLPLALVTVGRAMSNKRTPEEWSNALDTLKASLRSGTPGLDKSTQALVKFCYDNLESDMVRECFLTCALWPEDHNISKEELVQSWIGLGLLPDLSDIEEAHRFGLSVI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox