PRGDB00064465 (Zm.119793)

From PRG Wiki
Jump to: navigation, search
Zm.119793
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194691673 (BT034916)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0027N19 mRNA, complete cds

DNA Sequence

GATGAAGTTTGAAGCCAACACATCCATTTCTCGCTAGTAAGATCAAGAAAAATCCATTGAAGCCTACTTCCTACCTAAATCTTCATGGATCCTTGGAGTGAAAGTGAGGGCAAGAGAGCCCATGATCCTATCTTCAAATGTTTCAGCCAAAACCAAGGTCACCATCACTTCATGGAAAGGAGCACAGATGCTGCTGTTGCTCTCTCTGAGAGATGTAGATGCATCTGGGTTTCAGGTCCAATTATCGTGGGTGCAGGACCATCAGGGCTCGCTGCTGCTGCATGTCTCAAGGAGAAGGGAATCAGTAGCCTTATTCTTGAGCGCTCCAGATGCCTAGCTTCCCTCTGGCAGCTCAAGACATATGATCGTCTCAGCCTTCATCTTCCTCGGCAATTCTGTGAGCTTCCTCTCATGCCTTTCCCTGCCGACTATCCGATATATCCCTCAAAGCAGCAGTTTGTAGCCTACCTGGAGAGCTATGCTGCAAGTTTTGGCATATGTCCCACATACAATCGCACAGTGGTGTGCGCAGAGTATGATGAACAGCTTCTGTTATGGCGTGTGAGGACGCAGACTTCTGACACAACGGGAGAGGAGGTGGAGTATGTATCCCGGTGGCTTATTGTGGCAACTGGTGAGAATGCTGAGGCCGTGCAGCCGGATATCGGTGGTCTACAAGAGTTCCCGGGAACAATCATGCACACCAGTGCATATAAAAGTGGCAGTGCATTCACTGGGAAGCGTGTTCTCGTTGTCGGGTGTGGAAACTCCGGGATGGAGGTGTGCCTAGACCTCTGCAACCACAGTGCCGAGCCCCATATTGTTGTAAGAGATGCTGTACACATCTTGCCCAGGGAGATGCTTGGCCACTCCACCTTTGGTCTGTCAATGTGGCTCCTCAAGTGGCTCCCGGTCCACGTTGTGGACCGTGTTCTTCTGTGCATAGCGCGGGCCATGCTCGGGGATACTGCTCGGCTTGGGCTAAAGCGGCCGGCCTCTGGTCCTCTTCAGCTCAAGTCACTGTCTGGAAAGACCCCAGTTCTTGACGTCGGCACATTTGCAAAGATCAAGTCTGGAGATATCAAGGTACGACCTGCCGTAAGACAGGTATCAGGAAGAGCGGTAGAATTTGCGGACGGTGAGTTGGAGGAGTTCGACGCCATTGTGCTTGCGACTGGCTACAAGAGCAATGTCCCCTTCTGGTTGAAGGACCGAGTGTTATTTTCTGAAAAAGATGGATTGCCAAGAAAAGCATTTCCGAACGGGTGGAAGGGTGAGAAGGGCCTGTACTCGGTTGGGTTCACCCGGCGTGGACTGATGGGCACCTCGGTCGATGCCAGGAGGGTTGCCCACGACGTCGAGCAGCAATGGCGGAAGGCCAAAGGGACGCATCGGGACGGCGTTCCTCTACCTCTGGTCGCTGTTGTTTACCATGGTGATGGGTTGTGATTGTGAGTTGCCAAAGGGTGTATGTACGTACGCATGCATTCTGCTGCTTGCTTGTGTAGTGCTTTGTATAGGGTATTGTACTGTCAAtttctttttctttttttcttttGGCGTGCGTTCGTTTTGATGACTAACCATCCTACGTACTATAGGGGAGGGGGTGAATACTGAGGTGGCCGTGTTCTTCCAAAGTCGGGGCTCAGTTGACTTGGCCTCTAGCTACTGATAATGAAAGAAGCTTGCCTGGTTT


Protein sequences

Name Description Sequence
Zm.119793 translated coding region predicted by ESTScan from UniGene Zm.119793

MDPWSESEGKRAHDPIFKCFSQNQGHHHFMERSTDAAVALSERCRCIWVSGPIIVGAGPSGLAAAACLKEKGISSLILERSRCLASLWQLKTYDRLSLHLPRQFCELPLMPFPADYPIYPSKQQFVAYLESYAASFGICPTYNRTVVCAEYDEQLLLWRVRTQTSDTTGEEVEYVSRWLIVATGENAEAVQPDIGGLQEFPGTIMHTSAYKSGSAFTGKRVLVVGCGNSGMEVCLDLCNHSAEPHIVVRDAVHILPREMLGHSTFGLSMWLLKWLPVHVVDRVLLCIARAMLGDTARLGLKRPASGPLQLKSLSGKTPVLDVGTFAKIKSGDIKVRPAVRQVSGRAVEFADGELEEFDAIVLATGYKSNVPFWLKDRVLFSEKDGLPRKAFPNGWKGEKGLYSVGFTRRGLMGTSVDARRVAHDVEQQWRKAKGTHRDGVPLPLVAVVYHGDGL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023
21-431 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

SQNQGHHHFMERSTDAAVALSERCRCIWVSGPIIVGAGPSGLAAAACLKEKGISSLILERSRCLASLWQLKTYDRLSLHLPRQFCELPLMPFPADYPIYPSKQQFVAYLESYAASFGICPTYNRTVVCAEYDEQLLLWRVRTQTSDTTGEEVEYVSRWLIVATGENAEAVQPDIGGLQEFPGTIMHTSAYKSGSAFTGKRVLVVGCGNSGMEVCLDLCNHSAEPHIVVRDAVHILPREMLGHSTFGLSMWLLKWLPVHVVDRVLLCIARAMLGDTARLGLKRPASGPLQLKSLSGKTPVLDVGTFAKIKSGDIKVRPAVRQVSGRAVEFADGELEEFDAIVLATGYKSNVPFWLKDRVLFSEKDGLPRKAFPNGWKGEKGLYSVGFTRRGLMGTSVDARRVAHDVEQQWRK

HMMPanther: PTHR23023:SF5
21-431 PTHR23023:SF5,MONOOXYGENASE

SQNQGHHHFMERSTDAAVALSERCRCIWVSGPIIVGAGPSGLAAAACLKEKGISSLILERSRCLASLWQLKTYDRLSLHLPRQFCELPLMPFPADYPIYPSKQQFVAYLESYAASFGICPTYNRTVVCAEYDEQLLLWRVRTQTSDTTGEEVEYVSRWLIVATGENAEAVQPDIGGLQEFPGTIMHTSAYKSGSAFTGKRVLVVGCGNSGMEVCLDLCNHSAEPHIVVRDAVHILPREMLGHSTFGLSMWLLKWLPVHVVDRVLLCIARAMLGDTARLGLKRPASGPLQLKSLSGKTPVLDVGTFAKIKSGDIKVRPAVRQVSGRAVEFADGELEEFDAIVLATGYKSNVPFWLKDRVLFSEKDGLPRKAFPNGWKGEKGLYSVGFTRRGLMGTSVDARRVAHDVEQQWRK

FPrintScan: PR00469
IPR000103
51-73 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPIIVGAGPSGLAAAACLKEKGI

FPrintScan: PR00368
IPR013027
52-71 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PIIVGAGPSGLAAAACLKEK

Gene3D: G3DSA:3.50.50.60
53-230 G3DSA:3.50.50.60

IIVGAGPSGLAAAACLKEKGISSLILERSRCLASLWQLKTYDRLSLHLPRQFCELPLMPFPADYPIYPSKQQFVAYLESYAASFGICPTYNRTVVCAEYDEQLLLWRVRTQTSDTTGEEVEYVSRWLIVATGENAEAVQPDIGGLQEFPGTIMHTSAYKSGSAFTGKRVLVVGCGNSG

superfamily: SSF51905
53-336 SSF51905

IIVGAGPSGLAAAACLKEKGISSLILERSRCLASLWQLKTYDRLSLHLPRQFCELPLMPFPADYPIYPSKQQFVAYLESYAASFGICPTYNRTVVCAEYDEQLLLWRVRTQTSDTTGEEVEYVSRWLIVATGENAEAVQPDIGGLQEFPGTIMHTSAYKSGSAFTGKRVLVVGCGNSGMEVCLDLCNHSAEPHIVVRDAVHILPREMLGHSTFGLSMWLLKWLPVHVVDRVLLCIARAMLGDTARLGLKRPASGPLQLKSLSGKTPVLDVGTFAKIKSGDIKVR

HMMPfam: PF00743
IPR020946
54-379 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLAAAACLKEKGISSLILERSRCLASLWQLKTYDRLSLHLPRQFCELPLMPFPADYPIYPSKQQFVAYLESYAASFGICPTYNRTVVCAEYDEQLLLWRVRTQTSDTTGEEVEYVSRWLIVATGENAEAVQPDIGGLQEFPGTIMHTSAYKSGSAFTGKRVLVVGCGNSGMEVCLDLCNHSAEPHIVVRDAVHILPREMLGHSTFGLSMWLLKWLPVHVVDRVLLCIARAMLGDTARLGLKRPASGPLQLKSLSGKTPVLDVGTFAKIKSGDIKVRPAVRQVSGRAVEFADGELEEFDAIVLATGYKSNVPFWLKDRVL

FPrintScan: PR00368
IPR013027
176-194 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

SRWLIVATGENAEAVQPDI

FPrintScan: PR00469
IPR000103
216-240 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FTGKRVLVVGCGNSGMEVCLDLCNH

FPrintScan: PR00368
IPR013027
220-238 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEVCLDLC

Gene3D: G3DSA:3.50.50.60
231-365 G3DSA:3.50.50.60

MEVCLDLCNHSAEPHIVVRDAVHILPREMLGHSTFGLSMWLLKWLPVHVVDRVLLCIARAMLGDTARLGLKRPASGPLQLKSLSGKTPVLDVGTFAKIKSGDIKVRPAVRQVSGRAVEFADGELEEFDAIVLATG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox