PRGDB00064504 (Zm.126160)

From PRG Wiki
Jump to: navigation, search
Zm.126160
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 149098977 (EE184990)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

ZM_BFc0169K22.r ZM_BFc Zea mays cDNA clone ZM_BFc0169K22 5', mRNA sequence

DNA Sequence

CGCGACGCGTCGCCAACTCGCCATGGCGCTCCGTCTTCTGCTCCTCCTCGTCACTGTTACTACCGCCGCCGACGCGCTCACGCCGGACGGGCAGGCGCTGCTGGCGTTCAAGGCGGCCGTTCTCCAAGATCCCACGGGGGCGCTCGCCAACTGGGTCGCCACCGCCGCGGACCCCTGCTCATGGAACGGGGTCACCTGCTCCTCCCCTGACCCCGGCTCCGCGCAGCACCGCCGCGTCGTTGCGCTCTCCCTCCCTAAGAAGCGCCTCGTCGCGGAGCTCCCTAGGGCCCCGCTCCCGTCCTCGCTTCGCCACCTCAACCTCCGCAGCAACCGCCTCTTCGGGCCCATCCCACCCGCGCTCGTCGCTGGCGCACCCGCGCTCCAGAGCCTCGTCCTCTACGGGAACGCGCTCGACGGCCAGCTCCCCGAGGACCTCGGTGACCTGGCCTTCCTCCAGATCCTCGACCTCTCCTCCAACGCCATCAACGGCTCCCTCCCGGCCTCGATCCTCAAATGCCGCAGGCTCCGCGCTCTTGCGCTCGCGCGGAACAATCTCACAGGCTCGCTCCCCGCTGGGTTCGGCGCCCGCCTCGGGGCGCTGGAACGGCTCGACCTCTCCTTCAACGGCTTCTACGGCACCATCCCGGAGGACATCGGGAACCTGTCCAGGCTCCAGGGGACGGTCGACCTCTCGCACAACCACTTCTCGGGCCCCATCCCGGCGAGTCTTGGGAGGCTACCGGAGAAGGTCTACATCGATCTCACCTACAATAACCTCTCCGGTCCGATCCCGCAGAACGGGGCGTTGGAGAACCGGGGACCCACGGCGTTCGTTGGCACCCGGGGCTCTGCGGGCCCCCGCTTAAGACCCCTGCGCGCAGACACCATGCCTTCCTCAATCCTCCCTGCCCATG


Protein sequences

Name Description Sequence
Zm.126160 translated coding region predicted by ESTScan from UniGene Zm.126160

MALRLLLLLVTVTTAADALTPDGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCSSPDPGSAQHRRVVALSLPKKRLVAELPRAPLPSSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLPEDLGDLAFLQILDLSSNAINGSLPASILKCRRLRALALARNNLTGSLPAGFGARLGALERLDLSFNGFYGTIPEDIGNLSRLQGTVDLSHNHFSGPIPASLGRLPEKVYIDLTYNNLSGPIPQNGALENRGPTAFVGTRGSAGPRLRPLRADTMPSSILPAHX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-292 FAMILY NOT NAMED,FAMILY NOT NAMED

MALRLLLLLVTVTTAADALTPDGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCSSPDPGSAQHRRVVALSLPKKRLVAELPRAPLPSSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLPEDLGDLAFLQILDLSSNAINGSLPASILKCRRLRALALARNNLTGSLPAGFGARLGALERLDLSFNGFYGTIPEDIGNLSRLQGTVDLSHNHFSGPIPASLGRLPEKVYIDLTYNNLSGPIPQNGALENRGPTAFVGTRGSAGPRLRPLRADTMPSS

HMMPanther: PTHR24420:SF896
1-292 SUBFAMILY NOT NAMED

MALRLLLLLVTVTTAADALTPDGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCSSPDPGSAQHRRVVALSLPKKRLVAELPRAPLPSSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLPEDLGDLAFLQILDLSSNAINGSLPASILKCRRLRALALARNNLTGSLPAGFGARLGALERLDLSFNGFYGTIPEDIGNLSRLQGTVDLSHNHFSGPIPASLGRLPEKVYIDLTYNNLSGPIPQNGALENRGPTAFVGTRGSAGPRLRPLRADTMPSS

Seg: seg
2-20 seg

ALRLLLLLVTVTTAADALT

superfamily: SSF52058
16-258 L domain-like,LRR

ADALTPDGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCSSPDPGSAQHRRVVALSLPKKRLVAELPRAPLPSSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLPEDLGDLAFLQILDLSSNAINGSLPASILKCRRLRALALARNNLTGSLPAGFGARLGALERLDLSFNGFYGTIPEDIGNLSRLQGTVDLSHNHFSGPIPASLGRLPEKVYIDLTYNNLSGPIPQ

HMMPfam: PF08263
IPR013210
21-60 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

PDGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCS

Gene3D: G3DSA:3.80.10.10
22-262 no description

DGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCSSPDPGSAQHRRVVALSLPKKRLVAELPRAPLPSSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLPEDLGDLAFLQILDLSSNAINGSLPASILKCRRLRALALARNNLTGSLPAGFGARLGALERLDLSFNGFYGTIPEDIGNLSRLQGTVDLSHNHFSGPIPASLGRLPEKVYIDLTYNNLSGPIPQNGAL

Seg: seg
90-105 seg

PLPSSLRHLNLRSNRL

HMMPfam: PF13855
93-154 LRR_8,Leucine rich repeat

SSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLPEDLGDLAFLQILDLSSNAI

Seg: seg
166-178 seg

RRLRALALARNNL

HMMPfam: PF00560
IPR001611
193-214 LRR_1
Leucine-rich repeat

LERLDLSFNGFYGTIPEDIGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox