PRGDB00064507 (Zm.126394)

From PRG Wiki
Jump to: navigation, search
Zm.126394
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614821 (EU957123)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays clone 1583485 MLO-like protein 14 mRNA, complete cds

DNA Sequence

AGTTCCGCTCCAATTGCTTCTGCTGTGTCCTTTTCCTCCCAGCGAGCACCTTACCTTACCTCTCTCTCCTCGTTGTTGTGTTGTTGATTGATCCTGGAAACCTCAGCTCCACAAGCTCCCAAAAAGCAACAACCTTTACATCGTTGTTCATTGGGAGACAGGAGCGAGCGAGAGAGAGAGCTCGCGACAAGGTTTTGCCCGCACCATATCGTCCTCTCCCCGCAAGTTCCAAAAGCCAGGTCCAGGGACTAAATAGAGCAAAGGAAGCCTTTCATCATCGTCGTCATACACTAATCGAACGGGAGAATCGGAGGGAGGGACATACATCACGTTTTTGTGCTCCTCCGAGTCCGTCCTTCTCCAAGATCCCCCATTTTCCTTCTCGTTTCCAACCTCCTCCTCCTTCCTGACCGACCGATGGCGATGGTGTGACGCCGCCGCCCGTCCCCGACACCGACTGCGACCTCAGCATTTCCACACCGTCTCGGTCTGGGTCTGGTCTTCGTCTCCGCCTGCGCCTTCGTTTTGATCCTTAAGCTGAGCTTCCCTTCCCTTCCCCGAACGCCACCTCCGCATGTCCTACCATGGCGCTGGCTTCAATGTGATACGCGGAGGTGCGGTCGGTCGGTCGTGAGGAATAGGAAGAGGGTAGGAGAGGAGAAGAAGAGCCAGCGCCGGCGGGAGGGGAGATGGCGGGAGGCGAGGGGGAGATGCGGTCGCTGGCGCTCACGCCCACGTGGTCCGTCGCCACCGTGCTCACCCTCCTCGTCGCAGGCTCGCTCCTCATCGAGCGCTCCATCCACCGCCTCAGCAATTGGCCGAAGAAAACTCATCGGAATCCACTTTACAAAGCAATGGAGAAGATGAAAGAAGAAATGATGCTGCTTGGGTTCATATCTCTGCTTCTGGCTGCGACGTCAAGAATCATTTCGGGGATCTGCATCGACTCCAAGTACTACAACAGCAGATTCTCCCCGTGCACCAAAGAAGAGGTCCAAGAATCGATAAATGCAGAGCATGCCATTGCTCACGCGCGCAAGCATCTACTGGAGGTCATCCTGCACCATTCACCGAGGAGAAATCTGAAAACTAGTTACCATAACCATGAAGGCTGCCGTGAGGGATATGAGTCATTTGTTTCGCATGAAGGTTTGGAGCAGCTGCACCGGTTTATATTTGTAATGGCTGTGACTCATGTGACTTATAGCTGCCTGACGATGTTACTAGCAATACTCAAGATCCATAAATGGAGAAAATGGGAGGATGAAGCATTCAGGGATAATCATGAATCATTTTCTCAGATCGCATATGAGTCAGCAACTAGAAGGCAACCAGCACTTACCAAATCCTATTCATTCCGCTCTTGGAGCCAAAATAATGTGGTCATGTGGCTTGTTTGCTTTATTGCGCAATTTGGTCAGTCTGTTGTTCGAGCAGACTATCTTATCCTCCGCAAGGGTTTTATAATGACCCACAATCTTCCGCCAACATATGATTTCCACAATTACATGATACGCTCAATGGAAGAGGAGTTTGAGAAGATTGTCGGAGTGAGTGGACTGTTGTGGGGCTTCGTTGTTGCTTTTATGTTATTTAATGTAGACGGATCCAACCTGTACTTTTGGATAGCAATTCTTCCTGTAACTCTTGTTCTTCTGGTGGGTGCAAAGCTGCAGCATGTGATTGCGACTCTAACAGCAGAGGGCGCAAAGATGAGCACCTACGGGCCAAGGATACAGCCAAGGGATGATCTCTTTTGGTTCAAGAAACCAGAGTTTCTCCTTTGGTTGATACACTTCGTTCTCTTTCAGAATGCCTTCGAGTTGGCTTCGTTCTTCTGGTTCTGGTGGCAATTTGGTTATGATTCATGCTTCATCAAAAACCACCTTTTGGTATATTGCCGCCTTATACTGGGGTTTGCTGGACAGTTCCTGTGCAGTTACAGTACATTACCTGTATATGCTCTGGTCACTCAGATGGGGTCCAAGTACAAGGCTGCGCTGATCCCGCGGAGGATCAGGGAGACCATACATGGGTGGGGAAAGGCGACGAGGAAGAAGCGCCGGCGCCGCCGCGGCGACGACTCGACGGTCCGCACGGAGACGAGCACGGTGTGCTCGCtcacggacgacgacgaagacttcgaagacgaccaccatcaccaccaccacggaccGTCGTACGAGACCCCGAGAGCCGGGGGCCGCCCGCCGTACCTGAAGATCGAGACGCATCGTCAGTCGGGCAGCGGGCACGACGGCCCCAGGCCCGACGGCACCCCGTGCTTCCACACCAGCGGCAGCGGGCACGCCATGCTCCTGCGGCAGGCCTCCGTCTCCGCGCCGTCGTCGCCGTCGTACCGCGGAGGCAATAACGTGACAAGGTCTGCGTCCATGCCCGGGATCGCCGACGCGCGTGAGCCATGAGGAGCCCACAGCCCACTTGATGCGCGCCCGTGCATGCCATTGCTAGTGCAGACGTACTGAGGACTGAGCTGCTAGTGTAGCACCGGATTTGAAGGTATATCGATATATATACACACGAAAAGGTTTGGGGTGaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.126394 translated coding region predicted by ESTScan from UniGene Zm.126394

XFRSNCFCCVLFLPASTLPYLSLLVVVLLIDPGNLSSTSSQKATTFTSLFIGRQERARERARDKVLPAPYRPLPASSKSQVQGLNRAKEAFHHRRHTLIERENRREGHTSRFCAPPSPSFSKIPHFPSRFQPPPPSXPTDGDGVTPPPVPDTDCDLSISTPSRSGSGLRLRLRLRFDPXAELPFPSPNATSACPTMALASMXYAEVRSVGREEXEEGRRGEEEPAPAGGEMAGGEGEMRSLALTPTWSVATVLTLLVAGSLLIERSIHRLSNWPKKTHRNPLYKAMEKMKEEMMLLGFISLLLAATSRIISGICIDSKYYNSRFSPCTKEEVQESINAEHAIAHARKHLLEVILHHSPRRNLKTSYHNHEGCREGYESFVSHEGLEQLHRFIFVMAVTHVTYSCLTMLLAILKIHKWRKWEDEAFRDNHESFSQIAYESATRRQPALTKSYSFRSWSQNNVVMWLVCFIAQFGQSVVRADYLILRKGFIMTHNLPPTYDFHNYMIRSMEEEFEKIVGVSGLLWGFVVAFMLFNVDGSNLYFWIAILPVTLVLLVGAKLQHVIATLTAEGAKMSTYGPRIQPRDDLFWFKKPEFLLWLIHFVLFQNAFELASFFWFWWQFGYDSCFIKNHLLVYCRLILGFAGQFLCSYSTLPVYALVTQMGSKYKAALIPRRIRETIHGWGKATRKKRRRRRGDDSTVRTETSTVCSLTDDDEDFEDDHHHHHHGPSYETPRAGGRPPYLKIETHRQSGSGHDGPRPDGTPCFHTSGSGHAMLLRQASVSAPSSPSYRGGNNVTRSASMPGIADAREPXGAHSPLDARPCMPLLVQTY

Domains

Domain Start-End Description Sequence

Seg: seg
21-29 seg

LSLLVVVLL

Seg: seg
132-153 seg

PPPPSXPTDGDGVTPPPVPDTD

Seg: seg
162-175 seg

SRSGSGLRLRLRLR

Seg: seg
204-240 seg

AEVRSVGREEXEEGRRGEEEPAPAGGEMAGGEGEMRS

HMMPfam: PF03094
IPR004326
237-701 Mlo
Mlo-related protein

EMRSLALTPTWSVATVLTLLVAGSLLIERSIHRLSNWPKKTHRNPLYKAMEKMKEEMMLLGFISLLLAATSRIISGICIDSKYYNSRFSPCTKEEVQESINAEHAIAHARKHLLEVILHHSPRRNLKTSYHNHEGCREGYESFVSHEGLEQLHRFIFVMAVTHVTYSCLTMLLAILKIHKWRKWEDEAFRDNHESFSQIAYESATRRQPALTKSYSFRSWSQNNVVMWLVCFIAQFGQSVVRADYLILRKGFIMTHNLPPTYDFHNYMIRSMEEEFEKIVGVSGLLWGFVVAFMLFNVDGSNLYFWIAILPVTLVLLVGAKLQHVIATLTAEGAKMSTYGPRIQPRDDLFWFKKPEFLLWLIHFVLFQNAFELASFFWFWWQFGYDSCFIKNHLLVYCRLILGFAGQFLCSYSTLPVYALVTQMGSKYKAALIPRRIRETIHGWGKATRKKRRRRRGDDSTVRTE

Seg: seg
284-294 seg

KAMEKMKEEMM

Seg: seg
685-692 seg

RKKRRRRR

Seg: seg
710-724 seg

DDDEDFEDDHHHHHH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox