PRGDB00064517 (Zm.128317)

From PRG Wiki
Jump to: navigation, search
Zm.128317
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195650288 (EU972494)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 382230 disulfide oxidoreductase

DNA Sequence

AGTACAGTGAACGGTGCAAACTAGATATCTCTAGATCATCGGAACGGAGGTTATTGCATTGCATTGCATCCATCCAGCGCGCACAGAGAAAATGGAGTTGGTCGTGCTAATCGTCGGCGCTGGCCCAGCCGGACTGGCGACGGCGGCATGCCTGAGCCAGCGCTCGATCCCGTACCTGATCGTTGAGCGCGAGGACTGCAGCGCGTCGCTGTGGCGCTACCGTACCTACGACCGCGTGAAGCTCCACCTGTCCAAGGAGTTCAGCTGCCTGCCGTACATGCCGCACGAGGAAGACACCCCGACCTACATCCCCAAGGCGGAGTTCCTCAAGTACTTGGACTGCTACCGCGAGCATTTCGGCATCAAGCCCAGGTACTGCACTTCCGTCGTGTCGGCAGCATACGATGAGGGAGCCGGCCGCTGGGTCGTCGCCGCACGTGACACGGTCGAGGGCACGGAGATCCGGTACGCGGCCAGGTTCCTGGTTGTGGCCACCGGCGAGAATGGAGCGGGGAGGATTCCGGAGATCCAGGGCCTGGAGAGCTTCTGCGGGGAGGCTATCCACTCCTCGACCTACAAGTCTGGAAGAAGCTATGCCGGGAGAAGGGTTCTGGTGGTTGGTGCTGGAAATTCCGGGATGGAGATCGCCTATGATCTTGCAAACCATGGTGCCGACACCTCGATTGTTGTTCGCAGTCCGGTACACATAATGCCCAAGGAGCTGATCCGTCTCGGAATGACGTTTGTCCAATACATGCCAGTTACAATAGTTGACCTTTTCTTAGTGAAGCTAGCCGATTTCATATTTGGTGATCTATCAAATTATGGCATCGTACGGCCTGGAGTTGGCCCCCTACAACTCAAATCCAAAACAGGTAGATCTTCTGTAATTGATGTTGGGACAGCAGGGTTGATTAAGAAAGGCGTCGTGAAGGTGTTCAAGAGGATATCGAAGATCACTGGAAACAAAGTTCAGTTCGAATGCGGGAAGGACTGCGAATTCGATGCCATCGTGTTTGCGACAGGTTACAAGAGCAGTGCGAATCTATGGCTCAAGGCAGACGACAAGGGCATGGTGAATAGTGACGGACGTCCAAACACATGTCGTCCCAATATTTGGAAAGGAGAAAATGGCCTCTATTTCTCTGGTTTTAGGAGGATGGGATTGGCTGGTATTTGCATGGATGCTTATAATATTGCCAATGAAATCGTATCTGTCTACTGAAGATTTCTTGCTTGGCCTTTTAAGTCTAGTTAAATCTATATTAGGTCTTGGTTATCCGCGGTTCATTGCATCAAGAAATCAGTAGTAGTGCATGCATTGGCTTGTATGTCAACACATTGTCCTAAGATTGACTGTCTGTAAACGGTGCCTTTTATGCATAACAATAGCTCTCGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.128317 translated coding region predicted by ESTScan from UniGene Zm.128317

MELVVLIVGAGPAGLATAACLSQRSIPYLIVEREDCSASLWRYRTYDRVKLHLSKEFSCLPYMPHEEDTPTYIPKAEFLKYLDCYREHFGIKPRYCTSVVSAAYDEGAGRWVVAARDTVEGTEIRYAARFLVVATGENGAGRIPEIQGLESFCGEAIHSSTYKSGRSYAGRRVLVVGAGNSGMEIAYDLANHGADTSIVVRSPVHIMPKELIRLGMTFVQYMPVTIVDLFLVKLADFIFGDLSNYGIVRPGVGPLQLKSKTGRSSVIDVGTAGLIKKGVVKVFKRISKITGNKVQFECGKDCEFDAIVFATGYKSSANLWLKADDKGMVNSDGRPNTCRPNIWKGENGLYFSGFRRMGLAGICMDAYNIANEIVSVY

Domains

Domain Start-End Description Sequence

FPrintScan: PR00411
4-26 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

VVLIVGAGPAGLATAACLSQRSI

Gene3D: G3DSA:3.50.50.60
5-202 G3DSA:3.50.50.60

VLIVGAGPAGLATAACLSQRSIPYLIVEREDCSASLWRYRTYDRVKLHLSKEFSCLPYMPHEEDTPTYIPKAEFLKYLDCYREHFGIKPRYCTSVVSAAYDEGAGRWVVAARDTVEGTEIRYAARFLVVATGENGAGRIPEIQGLESFCGEAIHSSTYKSGRSYAGRRVLVVGAGNSGMEIAYDLANHGADTSIVVRS

HMMPanther: PTHR23023
5-377 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

VLIVGAGPAGLATAACLSQRSIPYLIVEREDCSASLWRYRTYDRVKLHLSKEFSCLPYMPHEEDTPTYIPKAEFLKYLDCYREHFGIKPRYCTSVVSAAYDEGAGRWVVAARDTVEGTEIRYAARFLVVATGENGAGRIPEIQGLESFCGEAIHSSTYKSGRSYAGRRVLVVGAGNSGMEIAYDLANHGADTSIVVRSPVHIMPKELIRLGMTFVQYMPVTIVDLFLVKLADFIFGDLSNYGIVRPGVGPLQLKSKTGRSSVIDVGTAGLIKKGVVKVFKRISKITGNKVQFECGKDCEFDAIVFATGYKSSANLWLKADDKGMVNSDGRPNTCRPNIWKGENGLYFSGFRRMGLAGICMDAYNIANEIVSVY

HMMPfam: PF00743
IPR020946
5-315 FMO-like
Flavin-containing monooxygenase-like

VLIVGAGPAGLATAACLSQRSIPYLIVEREDCSASLWRYRTYDRVKLHLSKEFSCLPYMPHEEDTPTYIPKAEFLKYLDCYREHFGIKPRYCTSVVSAAYDEGAGRWVVAARDTVEGTEIRYAARFLVVATGENGAGRIPEIQGLESFCGEAIHSSTYKSGRSYAGRRVLVVGAGNSGMEIAYDLANHGADTSIVVRSPVHIMPKELIRLGMTFVQYMPVTIVDLFLVKLADFIFGDLSNYGIVRPGVGPLQLKSKTGRSSVIDVGTAGLIKKGVVKVFKRISKITGNKVQFECGKDCEFDAIVFATGYKS

superfamily: SSF51905
5-211 SSF51905

VLIVGAGPAGLATAACLSQRSIPYLIVEREDCSASLWRYRTYDRVKLHLSKEFSCLPYMPHEEDTPTYIPKAEFLKYLDCYREHFGIKPRYCTSVVSAAYDEGAGRWVVAARDTVEGTEIRYAARFLVVATGENGAGRIPEIQGLESFCGEAIHSSTYKSGRSYAGRRVLVVGAGNSGMEIAYDLANHGADTSIVVRSPVHIMPKEL

HMMPanther: PTHR23023:SF5
5-377 PTHR23023:SF5,MONOOXYGENASE

VLIVGAGPAGLATAACLSQRSIPYLIVEREDCSASLWRYRTYDRVKLHLSKEFSCLPYMPHEEDTPTYIPKAEFLKYLDCYREHFGIKPRYCTSVVSAAYDEGAGRWVVAARDTVEGTEIRYAARFLVVATGENGAGRIPEIQGLESFCGEAIHSSTYKSGRSYAGRRVLVVGAGNSGMEIAYDLANHGADTSIVVRSPVHIMPKELIRLGMTFVQYMPVTIVDLFLVKLADFIFGDLSNYGIVRPGVGPLQLKSKTGRSSVIDVGTAGLIKKGVVKVFKRISKITGNKVQFECGKDCEFDAIVFATGYKSSANLWLKADDKGMVNSDGRPNTCRPNIWKGENGLYFSGFRRMGLAGICMDAYNIANEIVSVY

FPrintScan: PR00368
IPR013027
5-24 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

VLIVGAGPAGLATAACLSQR

FPrintScan: PR00411
131-140 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

LVVATGENGA

superfamily: SSF51905
171-376 SSF51905

RRVLVVGAGNSGMEIAYDLANHGADTSIVVRSPVHIMPKELIRLGMTFVQYMPVTIVDLFLVKLADFIFGDLSNYGIVRPGVGPLQLKSKTGRSSVIDVGTAGLIKKGVVKVFKRISKITGNKVQFECGKDCEFDAIVFATGYKSSANLWLKADDKGMVNSDGRPNTCRPNIWKGENGLYFSGFRRMGLAGICMDAYNIANEIVSV

FPrintScan: PR00411
172-197 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

RVLVVGAGNSGMEIAYDLANHGADTS

FPrintScan: PR00368
IPR013027
172-190 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGAGNSGMEIAYDLA

Gene3D: G3DSA:3.50.50.60
268-372 G3DSA:3.50.50.60

DVGTAGLIKKGVVKVFKRISKITGNKVQFECGKDCEFDAIVFATGYKSSANLWLKADDKGMVNSDGRPNTCRPNIWKGENGLYFSGFRRMGLAGICMDAYNIANE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox