PRGDB00064532 (Zm.131395)

From PRG Wiki
Jump to: navigation, search
Zm.131395
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614835 (EU957130)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 1583668 disulfide oxidoreductase

DNA Sequence

AACCAACACAACAACATCTCTTCCAGCTCCCACCAGCAACTACAATAGAACATCACATCCTAGCTAGCTACTAGCTCGAGCTCTCATCAGAAGATACATACTGATCATCGAtcaccagtcaccaccaccacctaaggctcagtcaccaccaccaccTAAGGCTCAGACGATCTCAGAGATTGAAAGCCACACATCAGCCATGGGGCTCCTTCCTACCGACCGCATGGACAGCCTCTTCTCCCCGCGCTGCCAGTGGGTGAACGGCCCCATCATCGTGGGCGCGGGGCCCTCGGGTCTCGCCGTGGCGGCGTGCCTGCGCGAGCAGGGCGTCCCCTACGTCATGCTGGAGCGCGCCGACTGCATCGCGTCGCTGTGGCAGAGGCGCACCTACGACCGCCTCAAGCTGCACCTGCCCAAGCAGTTCTGCGAGCTGCCGCGCATGCCCTTCCCCGACCACTACCCGGAGTACCCCACCCGCCGCCAGTTCATCGACTACCTCGAGGACTACGCCGCCAGGTTCGAGATCAGGCCGGAGTTCAGCACCACCGTGGTGTTGGCGCGCTACGACGAGACGTCGGGCCTCTGGCGCGTCACCACCTCGGCGCCCGCCGGCGCCAACGGTGGCGACGTGGAGTACATCGGCCGCTGGCTCGTCGTCGCCACCGGCGAGAACGCCGAGGCCGTCGTGCCCGACATCCCGGGTCTCGGCGGCTTCCACGGCAAGGTCACCCACGTCAGCGACTACAAGTCAGGGGAGGCCTACGCCGGGAAGCGCGTGCTCGTGGTCGGCTGCGGCAACTCCGGGATGGAGGTGTCGCTCGACCTCTCCGACCACGGGGCCCGCCCGGCCATGGTCGTGCGCGACGCTGTGCACGTCCTCCCCCGTGAGGTGCTCGGCAAGTCCACCTTCGAGCTCGCCGTGCTCCTCAGGCGCTGGCTCCCGCTCTGGCTCGTCGACAAGATCATGGTCATCCTCGCCTGGCTCGTCCTGGGCAACCTCGCCAGGCTCGGCCTccgccgccccgccgccggcccgcTTGAGCTCAAGGAGACACACGGCCGCACACCCGTCCTCGACACCGGCGCGCTCGCGCGCATCCGTGCCGGAGATATCGCCGTCGTCCCTGCCGTGGCACGTTTCCGAAAGGGCGGTCAGGTTGAGCTCGCCGACGGACGCACTCTCGACTTCGACGCCGTCATCCTCGCCACCGGATACCGCAGCAACGTTCCCCAGTGGCTCGAGAGCAGCAACGATTCCTTCAACAAGGAAGGATACCCCAAGACGGCCTTCCCTCACGGGTGGAAGGGTCAATCTGGGCTCTACGCCGTGGGTTTCACCCGGCGTGGTCTCTTGGGCGCCTCCACCGACGCCGTGCGCATTGCCAAGGACCTCGGCAACGTCTGGAGGGAGGAGACCAAGCCCACGAAGAGGGCCGGCGCCTGCCACAGGCGCTGCATCTCCGTCGTCTTCTAATCCGACCCACCAGCATGACGACGACGAATGAAGCTAACTTAATTACTGAAGcacacacataaacagacacacagacagatacacTTGTTCGTTCATGGTGTTTTAGTTAGTCAGTCCAATCCCCTTGGTTCGTTGTTCATTAATTTGTTCTTTGCCTGCCAGGTACATTAGTAGTAATACGGTGAGAGTGAGTTGAGTaaaaaaaaaaTGGAGCCCTCCCATCAGTAGGGAAGAAGTGAGTGAGCCCTAGAGGGGAttttttttACTGCAGCTATGGCCGCTAGCTTGGTGTATAGTAGCAACCTGTTGATGGAAGAAGAGGCTCTCTTTATTTTTCATTGACCTACCAGCATGTAAATTATTTAATTTCTTTGTTGTTGTATACACACCACCGGTGTATTATTAGTTACTCTACTGCAGCTTGTAGCTTGTAGTAGTAGCCAGTTTTAGTAGTGTATGGTTATATTTATATATAGTGATGAAGAGGTATATCACATCTTGATGaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.131395 translated coding region predicted by ESTScan from UniGene Zm.131395

XTNTTTSLPAPTSNYNRTSHPSXLLARALIRRYILIIDHQSPPPPKAQSPPPPKAQTISEIESHTSAMGLLPTDRMDSLFSPRCQWVNGPIIVGAGPSGLAVAACLREQGVPYVMLERADCIASLWQRRTYDRLKLHLPKQFCELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFSTTVVLARYDETSGLWRVTTSAPAGANGGDVEYIGRWLVVATGENAEAVVPDIPGLGGFHGKVTHVSDYKSGEAYAGKRVLVVGCGNSGMEVSLDLSDHGARPAMVVRDAVHVLPREVLGKSTFELAVLLRRWLPLWLVDKIMVILAWLVLGNLARLGLRRPAAGPLELKETHGRTPVLDTGALARIRAGDIAVVPAVARFRKGGQVELADGRTLDFDAVILATGYRSNVPQWLESSNDSFNKEGYPKTAFPHGWKGQSGLYAVGFTRRGLLGASTDAVRIAKDLGNVWREETKPTKRAGACHRRCISVVF

Domains

Domain Start-End Description Sequence

Seg: seg
23-37 seg

XLLARALIRRYILII

Seg: seg
40-55 seg

QSPPPPKAQSPPPPKA

HMMPanther: PTHR23023:SF5
55-474 MONOOXYGENASE,MONOOXYGENASE

AQTISEIESHTSAMGLLPTDRMDSLFSPRCQWVNGPIIVGAGPSGLAVAACLREQGVPYVMLERADCIASLWQRRTYDRLKLHLPKQFCELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFSTTVVLARYDETSGLWRVTTSAPAGANGGDVEYIGRWLVVATGENAEAVVPDIPGLGGFHGKVTHVSDYKSGEAYAGKRVLVVGCGNSGMEVSLDLSDHGARPAMVVRDAVHVLPREVLGKSTFELAVLLRRWLPLWLVDKIMVILAWLVLGNLARLGLRRPAAGPLELKETHGRTPVLDTGALARIRAGDIAVVPAVARFRKGGQVELADGRTLDFDAVILATGYRSNVPQWLESSNDSFNKEGYPKTAFPHGWKGQSGLYAVGFTRRGLLGASTDAVRIAKDLGNVWREETK

HMMPanther: PTHR23023
55-474 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

AQTISEIESHTSAMGLLPTDRMDSLFSPRCQWVNGPIIVGAGPSGLAVAACLREQGVPYVMLERADCIASLWQRRTYDRLKLHLPKQFCELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFSTTVVLARYDETSGLWRVTTSAPAGANGGDVEYIGRWLVVATGENAEAVVPDIPGLGGFHGKVTHVSDYKSGEAYAGKRVLVVGCGNSGMEVSLDLSDHGARPAMVVRDAVHVLPREVLGKSTFELAVLLRRWLPLWLVDKIMVILAWLVLGNLARLGLRRPAAGPLELKETHGRTPVLDTGALARIRAGDIAVVPAVARFRKGGQVELADGRTLDFDAVILATGYRSNVPQWLESSNDSFNKEGYPKTAFPHGWKGQSGLYAVGFTRRGLLGASTDAVRIAKDLGNVWREETK

FPrintScan: PR00469
IPR000103
89-111 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPIIVGAGPSGLAVAACLREQGV

FPrintScan: PR00368
IPR013027
90-109 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PIIVGAGPSGLAVAACLREQ

superfamily: SSF51905
91-375 FAD/NAD(P)-binding domain

IIVGAGPSGLAVAACLREQGVPYVMLERADCIASLWQRRTYDRLKLHLPKQFCELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFSTTVVLARYDETSGLWRVTTSAPAGANGGDVEYIGRWLVVATGENAEAVVPDIPGLGGFHGKVTHVSDYKSGEAYAGKRVLVVGCGNSGMEVSLDLSDHGARPAMVVRDAVHVLPREVLGKSTFELAVLLRRWLPLWLVDKIMVILAWLVLGNLARLGLRRPAAGPLELKETHGRTPVLDTGALARIRAGDIAVV

Gene3D: G3DSA:3.50.50.60
91-273 no description

IIVGAGPSGLAVAACLREQGVPYVMLERADCIASLWQRRTYDRLKLHLPKQFCELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFSTTVVLARYDETSGLWRVTTSAPAGANGGDVEYIGRWLVVATGENAEAVVPDIPGLGGFHGKVTHVSDYKSGEAYAGKRVLVVGCGNSGMEVS

HMMPfam: PF00743
IPR020946
92-432 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLAVAACLREQGVPYVMLERADCIASLWQRRTYDRLKLHLPKQFCELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFSTTVVLARYDETSGLWRVTTSAPAGANGGDVEYIGRWLVVATGENAEAVVPDIPGLGGFHGKVTHVSDYKSGEAYAGKRVLVVGCGNSGMEVSLDLSDHGARPAMVVRDAVHVLPREVLGKSTFELAVLLRRWLPLWLVDKIMVILAWLVLGNLARLGLRRPAAGPLELKETHGRTPVLDTGALARIRAGDIAVVPAVARFRKGGQVELADGRTLDFDAVILATGYRSNVPQWLESSNDSFNKEGYPKTAFP

FPrintScan: PR00469
IPR000103
255-279 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

YAGKRVLVVGCGNSGMEVSLDLSDH

FPrintScan: PR00368
IPR013027
259-277 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEVSLDLS

Gene3D: G3DSA:3.50.50.60
274-466 no description

LDLSDHGARPAMVVRDAVHVLPREVLGKSTFELAVLLRRWLPLWLVDKIMVILAWLVLGNLARLGLRRPAAGPLELKETHGRTPVLDTGALARIRAGDIAVVPAVARFRKGGQVELADGRTLDFDAVILATGYRSNVPQWLESSNDSFNKEGYPKTAFPHGWKGQSGLYAVGFTRRGLLGASTDAVRIAKDLG

Seg: seg
306-319 seg

LAVLLRRWLPLWLV

superfamily: SSF51905
382-445 FAD/NAD(P)-binding domain

RKGGQVELADGRTLDFDAVILATGYRSNVPQWLESSNDSFNKEGYPKTAFPHGWKGQSGLYAVG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox