PRGDB00064539 (Zm.133019)

From PRG Wiki
Jump to: navigation, search
Zm.133019
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195634700 (EU964701)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 280937 disulfide oxidoreductase

DNA Sequence

ACGATCCATATATCCCTTCCTCGTATATCCTTTCCTGAGTAGGAGAGAGAGTTGAGTTAGGAGTTTTGTGCTGATCATCTCGGTCGACCGAGAGATGGACCACCACTTCACTGAGATAGAGGGGAAGATGGCGCACGAGCCACTGGCACACAGCTCCACCTTCTCCGATGAGACGAAAGACAAAATGGAGCACGATTCACTGGTGTATAGTCCACGCAGCATCGCGAGGGCCACAACCACCGGCATCCCTGTCGGCGATCAAGGCGTGGCCGTGCTACGTGGGCCGCTTATCGTGGGTGCAGGGCCGGCGGGTCTGGCATGCGCGGCGTTGCTCACCATGTTATACATTCCCTACGTGCTCCTAGAGCGCGACGTGTGCGTAGCCTCAATGTGGCACCGCCGCACGTACCGCAGGTTGTGTCTGCACCTACCCAAGCGCTACTGTGAGCTCCCGCTCATGCACTTCCCACGCACCTACCCCACATATCCAACCCGGCAGCAGTTCCTTGTCTACCTCAATGAGTACATGCGCGCATTTGGCATCCGCCCATTTTTCAGCCTCGAGGTTGTCGCTGCCGAGTACAACGGTGAATACTGGTGTGTCCGCACCAAAGATGTCATCCCCACTGGCACTCTCAACGGCCAAAGCGGCGAGGAGTCTATCCGAGAGTACCGCTCCAAATGGCTGATCGTTGCCACAGGAGAGAACGCCGAGCCTGTTGTGCCTGACATGCCGGGAATCCATAACTTCAAGGGTCAAGTAATGCACTCATGTGACTACCGTAGCGGCGAGTCCTTCCAAGGCAAGAAGGTGCTAGTCGTTGGCTGCGGTAACTCTGGCATGGAGGTGTCTCTCGACCTCGCTAACCACAACGTGCACACATCGATGGCTGTTCGTCGTTCGGGGCACGTACTTCCAAGAGAGGTCATGGGGATCTCAACTTTTAGTTTGTCTGTGTGGCTCCTCAAGTTTCTACGTGTCCAAATAGTGGACCGGATTCTTCTTCTACTCGCTTGGTTCATTTTAGGAGACACTGCACAAATTGGTATTCCTCGGCCTAGCATGGGTCCAATGGAGCTCAAACAAGTGTCTGGTAAGACACCGGTGCTTGACGTGGGGACGATAGCACAGATTAAGTCCGGCAACATTAAAGTATTTCCTGCAATTCGAAGTTTCCAAGAATATGGTGTAGAGTTTACAAATGGTAGGATTGAATCATTTGATGTTGTGATTCTTGCCACAGGTTATAAGAGTAATGTTCCTTATTGGTTGAAGGAGAATGAATTTTTTTCACAGCAAAGTGGATTTCCAAACAAACCAAATGAATGGAAAGGAAAGGATGGACTCTATGCTGCTGGGTTCTCAAGGCGTGGTCTACTTGGTGTGTCTATGGATGCCACCAAAATTGCAGAGGATATTGCGCAGTCTTATAATAATATATATAAGCTACAAAGATCATAAGAACAAATGATATTTAACTATTTATCAATAATTTAGCTATCATCATTTGAGAGTTTTGTAAATATATGTACTAGTCTATTTGCATAAATTATAAGAGATGGATATGTTAGATAACAAATACTAGGCTAGCTTATCTATCAACGCACTCATTATATAATTGACATAGGCTAGTACATGTCACATTTTAGAGGTCCAACAAAATAGTTGATAGGATTGAGTTATTGCATGCTTTTATTTCTTTTTAATTTGGCAAATATTGTAAGTCATTTTTGTTATTATCAATCAATTGTAATGGGTAATGTATGGACGTTTTCATTCTTATGGCTATATTATTTGTTTATTACaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.133019 translated coding region predicted by ESTScan from UniGene Zm.133019

MAHEPLAHSSTFSDETKDKMEHDSLVYSPRSIARATTTGIPVGDQGVAVLRGPLIVGAGPAGLACAALLTMLYIPYVLLERDVCVASMWHRRTYRRLCLHLPKRYCELPLMHFPRTYPTYPTRQQFLVYLNEYMRAFGIRPFFSLEVVAAEYNGEYWCVRTKDVIPTGTLNGQSGEESIREYRSKWLIVATGENAEPVVPDMPGIHNFKGQVMHSCDYRSGESFQGKKVLVVGCGNSGMEVSLDLANHNVHTSMAVRRSGHVLPREVMGISTFSLSVWLLKFLRVQIVDRILLLLAWFILGDTAQIGIPRPSMGPMELKQVSGKTPVLDVGTIAQIKSGNIKVFPAIRSFQEYGVEFTNGRIESFDVVILATGYKSNVPYWLKENEFFSQQSGFPNKPNEWKGKDGLYAAGFSRRGLLGVSMDATKIAEDIAQSYNNIYKLQRS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023
18-443 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

DKMEHDSLVYSPRSIARATTTGIPVGDQGVAVLRGPLIVGAGPAGLACAALLTMLYIPYVLLERDVCVASMWHRRTYRRLCLHLPKRYCELPLMHFPRTYPTYPTRQQFLVYLNEYMRAFGIRPFFSLEVVAAEYNGEYWCVRTKDVIPTGTLNGQSGEESIREYRSKWLIVATGENAEPVVPDMPGIHNFKGQVMHSCDYRSGESFQGKKVLVVGCGNSGMEVSLDLANHNVHTSMAVRRSGHVLPREVMGISTFSLSVWLLKFLRVQIVDRILLLLAWFILGDTAQIGIPRPSMGPMELKQVSGKTPVLDVGTIAQIKSGNIKVFPAIRSFQEYGVEFTNGRIESFDVVILATGYKSNVPYWLKENEFFSQQSGFPNKPNEWKGKDGLYAAGFSRRGLLGVSMDATKIAEDIAQSYNNIYKLQR

HMMPanther: PTHR23023:SF5
18-443 MONOOXYGENASE,MONOOXYGENASE

DKMEHDSLVYSPRSIARATTTGIPVGDQGVAVLRGPLIVGAGPAGLACAALLTMLYIPYVLLERDVCVASMWHRRTYRRLCLHLPKRYCELPLMHFPRTYPTYPTRQQFLVYLNEYMRAFGIRPFFSLEVVAAEYNGEYWCVRTKDVIPTGTLNGQSGEESIREYRSKWLIVATGENAEPVVPDMPGIHNFKGQVMHSCDYRSGESFQGKKVLVVGCGNSGMEVSLDLANHNVHTSMAVRRSGHVLPREVMGISTFSLSVWLLKFLRVQIVDRILLLLAWFILGDTAQIGIPRPSMGPMELKQVSGKTPVLDVGTIAQIKSGNIKVFPAIRSFQEYGVEFTNGRIESFDVVILATGYKSNVPYWLKENEFFSQQSGFPNKPNEWKGKDGLYAAGFSRRGLLGVSMDATKIAEDIAQSYNNIYKLQR

FPrintScan: PR00411
52-74 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

GPLIVGAGPAGLACAALLTMLYI

FPrintScan: PR00368
IPR013027
53-72 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PLIVGAGPAGLACAALLTML

superfamily: SSF51905
54-344 FAD/NAD(P)-binding domain

LIVGAGPAGLACAALLTMLYIPYVLLERDVCVASMWHRRTYRRLCLHLPKRYCELPLMHFPRTYPTYPTRQQFLVYLNEYMRAFGIRPFFSLEVVAAEYNGEYWCVRTKDVIPTGTLNGQSGEESIREYRSKWLIVATGENAEPVVPDMPGIHNFKGQVMHSCDYRSGESFQGKKVLVVGCGNSGMEVSLDLANHNVHTSMAVRRSGHVLPREVMGISTFSLSVWLLKFLRVQIVDRILLLLAWFILGDTAQIGIPRPSMGPMELKQVSGKTPVLDVGTIAQIKSGNIKVF

Gene3D: G3DSA:3.50.50.60
55-239 no description

IVGAGPAGLACAALLTMLYIPYVLLERDVCVASMWHRRTYRRLCLHLPKRYCELPLMHFPRTYPTYPTRQQFLVYLNEYMRAFGIRPFFSLEVVAAEYNGEYWCVRTKDVIPTGTLNGQSGEESIREYRSKWLIVATGENAEPVVPDMPGIHNFKGQVMHSCDYRSGESFQGKKVLVVGCGNSGM

Seg: seg
57-69 seg

GAGPAGLACAALL

HMMPfam: PF00743
IPR020946
111-381 FMO-like
Flavin-containing monooxygenase-like

MHFPRTYPTYPTRQQFLVYLNEYMRAFGIRPFFSLEVVAAEYNGEYWCVRTKDVIPTGTLNGQSGEESIREYRSKWLIVATGENAEPVVPDMPGIHNFKGQVMHSCDYRSGESFQGKKVLVVGCGNSGMEVSLDLANHNVHTSMAVRRSGHVLPREVMGISTFSLSVWLLKFLRVQIVDRILLLLAWFILGDTAQIGIPRPSMGPMELKQVSGKTPVLDVGTIAQIKSGNIKVFPAIRSFQEYGVEFTNGRIESFDVVILATGYKSNVPYW

FPrintScan: PR00368
IPR013027
184-202 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

SKWLIVATGENAEPVVPDM

FPrintScan: PR00411
187-196 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

LIVATGENAE

FPrintScan: PR00411
228-253 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

KVLVVGCGNSGMEVSLDLANHNVHTS

FPrintScan: PR00368
IPR013027
228-246 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

KVLVVGCGNSGMEVSLDLA

Gene3D: G3DSA:3.50.50.60
240-434 no description

EVSLDLANHNVHTSMAVRRSGHVLPREVMGISTFSLSVWLLKFLRVQIVDRILLLLAWFILGDTAQIGIPRPSMGPMELKQVSGKTPVLDVGTIAQIKSGNIKVFPAIRSFQEYGVEFTNGRIESFDVVILATGYKSNVPYWLKENEFFSQQSGFPNKPNEWKGKDGLYAAGFSRRGLLGVSMDATKIAEDIAQS

superfamily: SSF51905
355-433 FAD/NAD(P)-binding domain

VEFTNGRIESFDVVILATGYKSNVPYWLKENEFFSQQSGFPNKPNEWKGKDGLYAAGFSRRGLLGVSMDATKIAEDIAQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox