PRGDB00064548 (Zm.136578)

From PRG Wiki
Jump to: navigation, search
Zm.136578
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195616885 (EU958155)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Zea mays clone 1675616 mRNA sequence

DNA Sequence

GAGCGCGCGCTCCTGGAGTGGCAGCGAATCTTGGAAGGAAAGCAGGGTCGAGAACAGGTGTACGGACAATGGCGGAGGCCGACGAGACGGCGGCGCTGCAGTACACACCGACGTGGATCGTGGCGGCGGTCTGCTCCATCATCGTGCTCATCTCCCTCGCCGCCGAGCGGGGCCTCCATCACCTCGGCAAGACGCTCAAGAAGAACCATCAGAGGCCGCTCTACGAGGCGCTCCTCAAGGTCAAAGAAGAGCTGATGCTTCTGGGGTTCATCTCCCTGCTGCTCACGGTGTTGCAGGGGACGATCCAGAGGACATGCATTCCTCCCAGCTGGACAGACTACATGCTGCCGTGCCAAAGACCGGGGCACGACGAGGCTCCTGCTGCGGCCGCCTCCATGGCGGCGCGTTTTGTCGCCGCCGACATCCTCGGTGGGATCAGTTGGGCACGCGTGCTCAGCGAGGGCGAGGGTGCGGCGGCCCAAGCCGGGCTGTGCGAGAAGGAGGGGAAAGTTCCACTGCTGTCCCTTGAAGCCCTGCATCAGCTGCACATCTTCATATTTGTTCTGGCTGTCTCGCACGTATTTTTCTGTGCTTCAACTATGTTGCCAGGATGTGCAAAGATACGCAAATGGAAGAAGTGGGAGGAGGAAATTCAGAAAATCGCTGCAGAAAATGGACCCAAGAAGGTGTTACCTATGCATCAAGTTTCATTTATCAGAGAACGTTACAAGGGTATTGGCACAGATTCCAAGACGTTGTGTTGGCTGCATTCATTTCGTAAGCAGTTTTATGGTTCGGTAGCTAAATCAGACTACGCCGCAATGCGTCTTGGTTTTATCATGACTCACTGTCGCGGGAACCTGAAATTTGATTTCCACAGATACATGGTGAGGGTTTTAGAGTCTGATTTTAAGAAAATAGTTGGTACAAGCTGGCACTTGTGGATCTTCGTGGTGATATTTCTGCTGCTCAATGTCAACGCCTCAACGGTTTGCACGCATACTTTTGGATAGCTTTCCTTCCCCTGGTTCTTCTGCTAGCCGTTGGCACAAAGCTGGAGCACGTAATAGCACAGCTAGCCTACGACGTAGCCGAGAAGCAGACGGCGATCGAGGGCGATCTGGTCGTGACGCCATCGGACCAGCACTTCTGGTTCGGGCGGCCGCGTATCATCCTGCACCTCATCCACTTCATCCTCTTCCAGAACGCGTTCGAGCTCGCCTTCTTCTTCTGGATACTGATGACCTATGGATTGGAGTCCTGCTTCATGGACCATATCGGTTTCCTGGTGCCCAGGCTCGTTCTCGGGGTCGTCATTCAGCTTCTCTGCAGCTACAGCACGCTGCCGCTTTATGCAATTGTTACCCAGATGGGGAGCTACTACAAGAAGGAGATCTTCAACGAGCATGTGCAGCAGGGCGTGCTGGGCTGGGCACAGAAGGCCAAGAAGAGATCGGGGGTGAAGGAGGTCAGCTCGCCGTCCGAACCCATGCACGGCGAAGATGCGGCCTAGGATTGGGATGCCGAGGGTAACGGGTAGCTGGCGAGGACAATGATGCAGCAGTTGTAAAGCACAGACTAGCTGTAATTTTTTTGCAGATAGAACCGTAAAACACTGCTCGTAATCTTTACTATTATAAATCACACCAGTTTTGACAGTACTCaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.136578 translated coding region predicted by ESTScan from UniGene Zm.136578

XARAPGVAANLGRKAGSRTGVRTMAEADETAALQYTPTWIVAAVCSIIVLISLAAERGLHHLGKTLKKNHQRPLYEALLKVKEELMLLGFISLLLTVLQGTIQRTCIPPSWTDYMLPCQRPGHDEAPAAAASMAARFVAADILGGISWARVLSEGEGAAAQAGLCEKEGKVPLLSLEALHQLHIFIFVLAVSHVFFCASTMLPGCAKIRKWKKWEEEIQKIAAENGPKKVLPMHQVSFIRERYKGIGTDSKTLCWLHSFRKQFYGSVAKSDYAAMRLGFIMTHCRGNLKFDFHRYMVRVLESDFKKIVGTSWHLWIFVVIFLLLNVNASTVCSILLDSFPSPGSSASRWHKAGARNSTASLRRSREADGDRGRSGRDAIGPALLVRAAAYHPAPHPLHPLPERVRARLLLLDTDDLWIGVLLHGPYRFPGAQARSRGRHSASLQLQHAAALCNCYPDGELLQEGDLQRACAAGRAGLGTEGQEEIGGEGGQLAVRTHARRRCGLGLGCRGXRVAGEDNDAAVVKHRLAVIFLQIEP

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
31-332 Mlo
Mlo-related protein

AALQYTPTWIVAAVCSIIVLISLAAERGLHHLGKTLKKNHQRPLYEALLKVKEELMLLGFISLLLTVLQGTIQRTCIPPSWTDYMLPCQRPGHDEAPAAAASMAARFVAADILGGISWARVLSEGEGAAAQAGLCEKEGKVPLLSLEALHQLHIFIFVLAVSHVFFCASTMLPGCAKIRKWKKWEEEIQKIAAENGPKKVLPMHQVSFIRERYKGIGTDSKTLCWLHSFRKQFYGSVAKSDYAAMRLGFIMTHCRGNLKFDFHRYMVRVLESDFKKIVGTSWHLWIFVVIFLLLNVNASTVC

Seg: seg
126-140 seg

APAAAASMAARFVAA

Seg: seg
206-224 seg

AKIRKWKKWEEEIQKIAAE

Seg: seg
387-401 seg

AAAYHPAPHPLHPLP

Seg: seg
408-416 seg

LLLLDTDDL

Seg: seg
439-451 seg

HSASLQLQHAAAL

Seg: seg
476-490 seg

GLGTEGQEEIGGEGG

Seg: seg
499-512 seg

RRRCGLGLGCRGXR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox