PRGDB00064559 (Zm.137539)

From PRG Wiki
Jump to: navigation, search
Zm.137539
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 149080800 (EE169868)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

ZM_BFc0145K10.f ZM_BFc Zea mays cDNA clone ZM_BFc0145K10 5', mRNA sequence

DNA Sequence

CGTGCCTAACGCCATGCTCTGCCCAGGTCGCACCCCCTCGTTGTCGTTGAGGTCCTCCAGCGAGATGTCCCCCTCGAGTGCCCTCACGATCTGACTCATCTTGGGGCGCTTCTTGGCCGAGTGGCGCACGGCTGCCGCGGCGCTGGCGGCCATGCGCGCCATCTCCATGGTGTCGTAGTTGCCCCGCAGCCTCGGGTCCGCGACGCCGTCGTAGTCGCCGTCGGCCAGCGCGCGCGACAGCGCCGGCCTCGCCCAGTCCACGAGGCTGTCGTCGACGTCGAGGAACGAGCGCGCGTCGCCGGCGTCGATGGGGCGCCGCCCCGTCAGGAGCTCCAGCAGCACCACGCCGTAGGAGAAGACGTCCGACTTGTCCGTCAGCTTCCCGCTCGACGCGTACTCCGGCGCCAGGTACCCGAACGTCCCCATCACACGGGTCGACACGTGCGTGTTGCTGTCCGACGTCAGCTTGGCCAGCCCGAAGTCGGCGACCTTGGCTTGGAAGTTGTTGTCGAGAAGAATGTTGGCCGACTTGATGTCGCGGTGAATGATCCGGGGATGGCCTTCATGCATGGTGACATAACACGGCGGATGTAAGATTCCGACGTGACATGGTCGCGTCACAAACCAAGTTTCTGATGACAGACAATTTCAAGCTGTTACGGATGCTCACTCACAGTCTTCATGCAGGTAGGCGAGGCCCTTGGCTGATCCGAGCGCAATGCGCAGCCTCGTCGACCACTCCATCACCGGCTGCCCTTTTCCTGCGTGCAAACCACCCCAACACGGAAACGTGCGTCAAGC


Protein sequences

Name Description Sequence
Zm.137539 translated coding region predicted by ESTScan from UniGene Zm.137539

XLTHVSVLGWFARRKRAAGDGVVDEAAHCARISQGPRLPAXRLXVSIRNSLKLSVIRNLVCDATMSRRNLTSAVFVTMHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRALEGDISLEDLNDNEGVRPGQSMALGT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-248 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLTHVSVLGWFARRKRAAGDGVVDEAAHCARISQGPRLPAXRLXVSIRNSLKLSVIRNLVCDATMSRRNLTSAVFVTMHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRALEGDISL

HMMSmart: SM00219
IPR020635
2-242 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LTHVSVLGWFARRKRAAGDGVVDEAAHCARISQGPRLPAXRLXVSIRNSLKLSVIRNLVCDATMSRRNLTSAVFVTMHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRAL

HMMSmart: SM00220
IPR002290
2-205 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LTHVSVLGWFARRKRAAGDGVVDEAAHCARISQGPRLPAXRLXVSIRNSLKLSVIRNLVCDATMSRRNLTSAVFVTMHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRL

superfamily: SSF56112
IPR011009
78-250 Protein kinase-like (PK-like)
Protein kinase-like domain

MHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRALEGDISLED

HMMPfam: PF00069
IPR017442
78-168 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

MHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAG

Gene3D: G3DSA:1.10.510.10
78-242 no description

MHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRAL

HMMPanther: PTHR24420
78-262 FAMILY NOT NAMED,FAMILY NOT NAMED

MHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRALEGDISLEDLNDNEGVRPGQS

HMMPanther: PTHR24420:SF782
78-262 SUBFAMILY NOT NAMED

MHEGHPRIIHRDIKSANILLDNNFQAKVADFGLAKLTSDSNTHVSTRVMGTFGYLAPEYASSGKLTDKSDVFSYGVVLLELLTGRRPIDAGDARSFLDVDDSLVDWARPALSRALADGDYDGVADPRLRGNYDTMEMARMAASAAAAVRHSAKKRPKMSQIVRALEGDISLEDLNDNEGVRPGQS

PatternScan: PS00108
IPR008271
85-97 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSANILL

Seg: seg
214-229 seg

MARMAASAAAAVRHSA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox