PRGDB00064563 (Zm.137602)

From PRG Wiki
Jump to: navigation, search
Zm.137602
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219884368 (BT053952)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0069K21 mRNA, complete cds

DNA Sequence

CCGACGGCGAGACGCTCGTCTCAGCCGACGGGACGTTCACCTTGGGATTCTTCTCTCCCGGGGCGTCGACCAAGAGATACCTCGGCATCTGGTTCTCGGCGTCCAGTGTCGCCGTCTGCTGGGTGGCGAACGGTGGCCGCCCTGTGAATGGCAACTCCGGCGTGCTGGTCGTCAGAGACACGGGAAGCCTTCTGCTTCTAGACGGCTCTGGCCAGACCATATGGTCGTCGAACTCCACCAGCTCATCGTCATCAGCGGAGGCGCAGCTCCTCAACTCCGGCAACCTCGTCGTCCGCGACGGAGgcagcagcagcagcagcGACGCCATCCTGTGGCAATCGTTCGATCACCCGTCGAACACCCTGCTGTCCGGCATGAAGCTGGGCAAGAACAAGTGGACCGGCGCCGAGTGGTACCTCACGTCGTGGCGCTCGGCCGACGACCCGTCGCCGGGGGCCTACCGCCGCGCGCTGGACACCAGCGGGCTGCCCGAGCTTGTGGTGTGGGAGGGCAACGTCAGGACCTACCGCACCGGCCCGTGGAACGGCCGGTGGTTCAGCGGCGTCCCGGAGGTGTCGGCGTACAGGAACTTGATCTGGTACCAGGTGACGACAAGCCCAGCGGAGGTATCCTACGGCTACACCTCCAACCCCGGTGCCGCATTGACCCGTGTCGTGCTGACCGACGCCGGCGTGGCCAAGCGCCTGGTGTGGGACGCGGGCGCCCGGACGTGGCAGACCTTCTTCCAGGGCCCCAGGGACGTCTGCGACGCCTACGGCAAGTGCGGGGCGTTCGGGCTGTGCGACGCCGGCGCGGCGTCGACGTGGTTCTGCACCTGCCTCACGGGGTTCAGCCCGGCGTCGCCGCCCGCGTGGTCCTTGAGGGACACCTCAGGCGGATGCAAGCGGAACGTGAAGCTGGACTGTGCCAATAACGGGAGTGGGACGACGACGACGACAGACGGTTTCCTGTTGGTCCGCGGAGTGAAGCTACCGGACACACACAACGCGACGGTGGACATGAGCATCACGGTGGAGGACTGCGCGGCGAGGTGCCTCGCCAACTGCTCGTGCTTGGCCTACGCCGCCGCAGATATCCGCGGCGGCGACGTCCGTAGCGGCTGCGTGATGTGGACGGATGACATCGTCGACCTCCGATACGTGGACAAAGGGCAAGATCTCTACCTGAGGCTGGCCAGGTCCGAGCTGCCGGCGGCGGCGGGGCCCTCGCCGCAACGGCCGTTTCGTACCGCACCAGTTGTTGGTGCTTCCGCAGCTGCCGTCGCCGTGGTTCTTATTGTTCTGTCGGTCGTGCTTGTGATTAGGCGGCGCCGGCGACCAATAATCCCAGCTGCTCAGAGTGCCTCTCCGAGTGTCCCTTCTACTGAACTGCGCAGACCTCCGTCAGTCCCTTCTGTTGACCTGTCTAGTTTGAGGAGGGCTACAAATGATTTCTCTGCAGACAATGTCATTGGGCGTGGAGGATTCAGCACCGTATTTGAGGGCAATTTAGCTGATGGTACCAAGGTTGCCGTGAAGAGGCTCACACAATCTTACCTTACCGATGGAGGTGGTGAGACTTTCATGAGAGAAGTGGAAGTGATGTCAGAGCTCAAGCACGAGAACCTCGCTCGTCTCCTTGCTTACTGCAAGGACGGAAATGAGCGGATACTGGTCTACGAGTACATGGAGAACAGGAGCTTGAACCTATGCATATTCGCAAGAGACGCCAACCAACGCGCTGTGTTGAACTGGGAGCGGAGGCTGGAGATCATCGTAGGAGTCGCCAGAGGCGTTGCTTATCTGCACGGACTAAGCAAGGTGGTGATACACAGGGATCTGAAACCGTCCAACGTGCTCTTGGACGGAAACTGGAGAGCAAAAATTGCAGATTTTGGCACCGCCAAAGTGTTCGTCGATGGCCAGACGAATCCGACACTGGTACAGACAGAGGGATACAGGGCTCCAGAGTACACGGCGCGAGGGCCGAGCCTGACGCTGAAGTGCGACGTGTATAGCTTTGGAGTCGTCCTGATCGAGATCGTCAGTGGCCAAAGGAACAGCAGCAACCAGACGCTCGTTTCCGATGCACGGGAGTCTTGGAGCCAGAATAAGATCAAGGAGAACCTTCTGGATCCAGCCGTGGGCCAGCCGGGGCCAGAGATCCTCCTTCGGCTGGAGAGGTGCGTGCAGGTCGGCCTTCTCTGCGTGCAGCAGTCGCCAGCTGACAGGCCATCCATGGCTGAAGTAGTCGCGATGCTGACGGTGAACGGCACCAGCAGCTCGCAGATCCGTTCGCACCGCAGTGCCGCTGCCGCTGCCGCCGCCACTCCTCTCGCGACGCAGGACGCGTCGTCTGGAGCACACGGCGACTCCATCTATCTCACGTAGACGGCGAAGCAAAAGCCCACGACGACTCCATCTATCATTCTCACGTAGACGACGACGAAGCACGCGGCGACTCCATTCATCTCGATTTCTGATCTTGGAGTTGGATCTGTCACGGCGGTATTGGTTAGTGGTACACGATTACACGAGCATTGCAGTTGCAGGAAGCAGCAGCAAAAGTATATATACTAGCGAATTCATGTATGTTGCTGGAATATTACCAAAAACTTCATGTTCATGGGAACTTTTACAAAAGAGTAGTGTTGTTGTTGTATAGC


Protein sequences

Name Description Sequence
Zm.137602 translated coding region predicted by ESTScan from UniGene Zm.137602

XDGETLVSADGTFTLGFFSPGASTKRYLGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSWRSADDPSPGAYRRALDTSGLPELVVWEGNVRTYRTGPWNGRWFSGVPEVSAYRNLIWYQVTTSPAEVSYGYTSNPGAALTRVVLTDAGVAKRLVWDAGARTWQTFFQGPRDVCDAYGKCGAFGLCDAGAASTWFCTCLTGFSPASPPAWSLRDTSGGCKRNVKLDCANNGSGTTTTTDGFLLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIVDLRYVDKGQDLYLRLARSELPAAAGPSPQRPFRTAPVVGASAAAVAVVLIVLSVVLVIRRRRRPIIPAAQSASPSVPSTELRRPPSVPSVDLSSLRRATNDFSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLTVNGTSSSQIRSHRSAAAAAAATPLATQDASSGAHGDSIYLTXTAKQKPTTTPSIILTXTTTKHAATPFISISDLGVGSVTAVLVSGTRLHEHCSCRKQQQKYIY

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
1-111 BULB_LECTIN
Bulb-type lectin domain

XDGETLVSADGTFTLGFFSPGASTKRYLGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAIL

HMMSmart: SM00108
IPR001480
1-118 Bulb-type mannose-specific lectin
Bulb-type lectin domain

XDGETLVSADGTFTLGFFSPGASTKRYLGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHP

HMMPanther: PTHR24420:SF745
2-755 OS04G0634000 PROTEIN

DGETLVSADGTFTLGFFSPGASTKRYLGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSWRSADDPSPGAYRRALDTSGLPELVVWEGNVRTYRTGPWNGRWFSGVPEVSAYRNLIWYQVTTSPAEVSYGYTSNPGAALTRVVLTDAGVAKRLVWDAGARTWQTFFQGPRDVCDAYGKCGAFGLCDAGAASTWFCTCLTGFSPASPPAWSLRDTSGGCKRNVKLDCANNGSGTTTTTDGFLLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIVDLRYVDKGQDLYLRLARSELPAAAGPSPQRPFRTAPVVGASAAAVAVVLIVLSVVLVIRRRRRPIIPAAQSASPSVPSTELRRPPSVPSVDLSSLRRATNDFSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLT

HMMPanther: PTHR24420
2-755 FAMILY NOT NAMED,FAMILY NOT NAMED

DGETLVSADGTFTLGFFSPGASTKRYLGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSWRSADDPSPGAYRRALDTSGLPELVVWEGNVRTYRTGPWNGRWFSGVPEVSAYRNLIWYQVTTSPAEVSYGYTSNPGAALTRVVLTDAGVAKRLVWDAGARTWQTFFQGPRDVCDAYGKCGAFGLCDAGAASTWFCTCLTGFSPASPPAWSLRDTSGGCKRNVKLDCANNGSGTTTTTDGFLLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIVDLRYVDKGQDLYLRLARSELPAAAGPSPQRPFRTAPVVGASAAAVAVVLIVLSVVLVIRRRRRPIIPAAQSASPSVPSTELRRPPSVPSVDLSSLRRATNDFSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLT

superfamily: SSF51110
IPR001480
28-149 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSWRSADDP

HMMPfam: PF01453
IPR001480
38-150 B_lectin
Bulb-type lectin domain

AVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSSSSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSWRSADDPS

Seg: seg
64-67 seg

LLLL

Seg: seg
76-85 seg

SSNSTSSSSS

Seg: seg
100-108 seg

DGGSSSSSD

Gene3D: G3DSA:2.90.10.10
IPR001480
151-188 no description
Bulb-type lectin domain

PGAYRRALDTSGLPELVVWEGNVRTYRTGPWNGRWFSG

HMMPfam: PF00954
IPR000858
176-287 S_locus_glycop
S-locus glycoprotein

YRTGPWNGRWFSGVPEVSAYRNLIWYQVTTSPAEVSYGYTSNPGAALTRVVLTDAGVAKRLVWDAGARTWQTFFQGPRDVCDAYGKCGAFGLCDAGAASTWFCTCLTGFSPA

ProfileScan: PS50948
IPR003609
309-399 PAN
Apple-like

CANNGSGTTTTTDGFLLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIVDLRYVDKGQDLYLRLA

Seg: seg
316-320 seg

TTTTT

HMMPfam: PF08276
IPR013227
318-385 PAN_2
PAN-2 domain

TTTDGFLLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIVDL

HMMSmart: SM00473
IPR003609
318-398 divergent subfamily of APPLE domains
Apple-like

TTTDGFLLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIVDLRYVDKGQDLYLRL

Gene3D: G3DSA:2.60.120.200
IPR013320
416-505 no description
Concanavalin A-like lectin/glucanase, subgroup

RTAPVVGASAAAVAVVLIVLSVVLVIRRRRRPIIPAAQSASPSVPSTELRRPPSVPSVDLSSLRRATNDFSADNVIGRGGFSTVFEGNLA

Seg: seg
418-461 seg

APVVGASAAAVAVVLIVLSVVLVIRRRRRPIIPAAQSASPSVPS

Seg: seg
465-480 seg

RRPPSVPSVDLSSLRR

superfamily: SSF56112
IPR011009
474-783 Protein kinase-like (PK-like)
Protein kinase-like domain

DLSSLRRATNDFSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLTVNGTSSSQIRSHRSAAAAAAATPLATQD

ProfileScan: PS50011
IPR000719
485-756 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLTV

HMMSmart: SM00220
IPR002290
485-756 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLTV

HMMSmart: SM00219
IPR020635
485-754 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSADNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAML

HMMPfam: PF00069
IPR017442
488-751 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DNVIGRGGFSTVFEGNLADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVV

PatternScan: PS00107
IPR017441
491-513 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFSTVFEGNLADGTKVAVK

Gene3D: G3DSA:3.30.200.20
506-555 no description

DGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNE

Gene3D: G3DSA:1.10.510.10
556-758 no description

RILVYEYMENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDGNWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVSGQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPADRPSMAEVVAMLTVNG

PatternScan: PS00108
IPR008271
609-621 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPSNVLL

Seg: seg
770-776 seg

AAAAAAA

Seg: seg
796-816 seg

TXTAKQKPTTTPSIILTXTTT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox