PRGDB00064575 (Zm.138719)

From PRG Wiki
Jump to: navigation, search
Zm.138719
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 24934195 (CA452413)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

Rxo#1_A04 subtracted cDNA library of maize inbred line B73 infected with Xanthomonas oryzae pv. oryzicola strain BLS222 Zea mays cDNA clone Rxo#1_A04, mRNA sequence

DNA Sequence

ACCTTTGGGGTATGCTAATGATATTCTTGCTACTTAATGTTCACGCTGTTACTTGTGCTCGGAAGTAAGATGGAGCATATTATCACGGAGTTGGCTCTTGAGGTTATCCAAAAGCATACGGCAATAGAAGGGGTTCTAGTTGTAACTCCTTCGGATGAACTCTTTTGGTTCCACCGGCCTAAACTAGTCCTTCTCTTGATTCATATCATCTTGTTCCAGAATGCATTTGAGATTGCATTCTTCTTTTGGTTGCTGGTAACATATGGGTTTAATTCGTGCATTATGGGAAAACCGGCATATGTTATTACTCGTGTGGTGATAAGTGTCATCAGCCAAGTCCTATGTGGATATAGCACCCTACCTCTCTATGCTCTCATCTCTCAAATGGGAAGTTCTTTCAAGAAGGCCATTTTCGATGAAAATGTCTCCGAAGGTCTCATCAATTGGGCAGAAAATGCTAGGAGGCGTAATAGAATGCCAACAAGTGTTGGTGACAATTCACCTGTTGGTGAAGGAATTCAAATGTCAAATCAGACACAAAGAGAATCATCAATGGAACAGGGAACTGCAAGGTTGATCTAAGTGAAAATATGAATGT


Protein sequences

Name Description Sequence
Zm.138719 translated coding region predicted by ESTScan from UniGene Zm.138719

MEHIITELALEVIQKHTAIEGVLVVTPSDELFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVTYGFNSCIMGKPAYVITRVVISVISQVLCGYSTLPLYALISQMGSSFKKAIFDENVSEGLINWAENARRRNRMPTSVGDNSPVGEXNSNVKSDTKRIINGTGNCKVDLSENMNV

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-151 Mlo
Mlo-related protein

MEHIITELALEVIQKHTAIEGVLVVTPSDELFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVTYGFNSCIMGKPAYVITRVVISVISQVLCGYSTLPLYALISQMGSSFKKAIFDENVSEGLINWAENARRRNRMPTSVGDNSPVGEXNS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox